KEGG   Azospirillum brasilense Sp245: AZOBR_p150030Help
Entry
AZOBR_p150030     CDS       T02152                                 

Gene name
pit
Definition
(GenBank) low-affinity phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
abs  Azospirillum brasilense Sp245
Brite
KEGG Orthology (KO) [BR:abs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AZOBR_p150030 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TctB
Motif
Other DBs
NCBI-ProteinID: CCD00166
UniProt: G8ARV5
Position
AZOBR_p1:599223..600230
Genome map
AA seq 335 aa AA seqDB search
MEAATLALPILIGLIGVALLFDFLNGLHDAANSIATVVSTRVLSPRTAVAMAAFFNFIAF
LFFGLHVATTIGTGIVGAGVVDPHVIFGALMGAIVWNVFTWWLGIPSSSSHALIGGLVGA
GVAKAGLDAVVVSGLAKTAAAIVVSPVVGFLLASVMIVAVSWIFRRSTPFAVDRLFRHIQ
IGSAALYSLGHGGNDAQKTMGIIAVLLYSQGLLGETFHVPFWVVITCQAAMGLGTLFGGW
RIVKTMGSKLTDLKPVQGSCAETGGAITLFVATWLGVPVSTTHTITGAIIGVGAARRTSA
VRWGLAQGIVMAWVITLPATAVVGALFYELSLALW
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgctaccctcgccctgcccatcctcatcgggctgatcggcgtcgccctcctc
ttcgatttcctcaacgggctgcacgacgcggccaactccatcgcgacggtcgtctccacc
cgcgtgctgtcgccgcggaccgccgtcgcgatggccgccttcttcaatttcatcgccttc
ctgttcttcgggctgcatgtggcgaccaccatcggcaccggcatcgtcggggcgggggtg
gttgacccgcacgtcattttcggcgcgctgatgggcgccatcgtctggaacgtcttcacc
tggtggctgggcatcccgtccagctcctcccacgcgctgatcggcggcctcgtcggggcc
ggcgtggcgaaggccgggctggacgccgtggtggtgtccggtctggcgaagaccgccgcg
gccatcgtcgtctcgccggtggtcggcttcctgctggccagcgtgatgatcgtggcggtg
tcctggatcttccggcgcagcacgcccttcgcggtcgaccggctgttccgccacatccag
atcggctccgccgcgctctacagcctgggacacggcggcaacgacgcccagaagaccatg
ggcatcatcgccgtcctgctctattcccagggcctgttgggggaaaccttccacgtgccc
ttctgggtggtcatcacctgtcaggccgcgatggggctgggcacgctgttcggcggctgg
cgcatcgtcaagaccatggggtccaagctgaccgacctgaagccggtccagggctcctgc
gcggagaccggcggggccatcaccctgttcgtcgcgacgtggctcggcgtgccggtcagc
acgacccacaccatcaccggggccatcatcggcgtcggcgccgcccgccgcaccagcgcg
gtgcgctgggggctggcgcagggcatcgtcatggcctgggtcatcactctgccggcgacc
gccgtcgtcggcgcgctcttctacgagctgtcgctggcgctgtggtga

DBGET integrated database retrieval system