KEGG   Azospirillum brasilense Sp245: AZOBR_p210011Help
Entry
AZOBR_p210011     CDS       T02152                                 

Definition
(GenBank) protein of unknown function
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00071  Fatty acid degradation
abs00072  Synthesis and degradation of ketone bodies
abs00280  Valine, leucine and isoleucine degradation
abs00310  Lysine degradation
abs00362  Benzoate degradation
abs00380  Tryptophan metabolism
abs00620  Pyruvate metabolism
abs00630  Glyoxylate and dicarboxylate metabolism
abs00640  Propanoate metabolism
abs00650  Butanoate metabolism
abs00900  Terpenoid backbone biosynthesis
abs01100  Metabolic pathways
abs01110  Biosynthesis of secondary metabolites
abs01120  Microbial metabolism in diverse environments
abs01130  Biosynthesis of antibiotics
abs01200  Carbon metabolism
abs01212  Fatty acid metabolism
abs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZOBR_p210011
   00630 Glyoxylate and dicarboxylate metabolism
    AZOBR_p210011
   00640 Propanoate metabolism
    AZOBR_p210011
   00650 Butanoate metabolism
    AZOBR_p210011
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZOBR_p210011
   00072 Synthesis and degradation of ketone bodies
    AZOBR_p210011
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZOBR_p210011
   00310 Lysine degradation
    AZOBR_p210011
   00380 Tryptophan metabolism
    AZOBR_p210011
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZOBR_p210011
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZOBR_p210011
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZOBR_p210011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abs04147]
    AZOBR_p210011
Enzymes [BR:abs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZOBR_p210011
Exosome [BR:abs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZOBR_p210011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCD01347
UniProt: G8ATT8
Position
AZOBR_p2:complement(9741..10748)
Genome map
AA seq 335 aa AA seqDB search
MTDTVVIAGAARTPMGGFQGDLQGLTAPQLGSAAIKAALERAGVKPEAVDEVFMGNVLPA
GLGQAPARQASLGAGIPEAAGCTTISKVCGSGMKAVMLATDLIKAGSAEIMVAGGMESMS
NAPYLLDRARGGYPHGPRPRARPHVPRRAGGRLRPRAPDGHLRGGMRHPLPVHPRGAGQL
RHREPEPRPPRHRGRQLRQGDHRGHGEGPQGRHGGGEGRAAAEGRPGQDPDAEAGLRQGR
HGDGGQRLLHFGWRGGAGADHAVERGEAGPADPGGDQGPRQPRPGPGLVHHRPGRCDQQG
AGARRLGGQGRGPLRAERGLRRGRHGGDARTRHPA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataccgttgtgatcgcgggcgccgcccgcaccccgatgggcggctttcagggc
gacttgcagggcctgaccgcgccgcagctcggctccgccgccatcaaggcggcgctggag
cgcgccggggtcaagccggaggcggtggacgaggtgttcatgggcaacgtcctgcccgcc
ggccttgggcaggcgccggcccgtcaggcgtcgctcggcgccggcattccggaggccgcg
ggctgcacgaccatttccaaggtctgcgggtcgggcatgaaggcggtgatgctcgccacc
gacctcatcaaggccggctcggcggagatcatggtggccggcggcatggaaagcatgtcc
aacgccccctacctgctcgaccgcgcgcggggcggctacccgcatgggccacggccgcgt
gctcgaccacatgttcctcgacgggctggaggacgcctacgaccgcgggcgcctgatggg
caccttcgcggaggaatgcgccacccactaccagttcacccgcgaggcgcaggacaacta
cgccatcgagagcctgaaccgcgcccgccgcgccaccgaggacggcagcttcgtcaagga
gatcaccgcggtcatggtgaagggccgcaagggcgacacggtggtggagaaggacgagca
gccgctgaaggccgacccggccaagatcccgacgctgaagccggccttcgccaaggacgg
cacggtgacggcggccaacgcctcctccatttcggatggcgcggcggcgctggtgctgac
cacgcggtcgaacgcggagaagctgggcctgccgatcctggcggagatcaaggcccacgc
caaccacgcccaggccccggcctggttcaccaccgccccggtcggtgcgatcaacaaggt
gctggagcgcgccggctgggcggccaaggacgtggacctctacgagctgaacgaggcctt
cgccgtggtcgccatggcggcgatgcgcgaactcgacatcccgcatga

DBGET integrated database retrieval system