KEGG   Azospirillum brasilense Sp245: AZOBR_p330020Help
Entry
AZOBR_p330020     CDS       T02152                                 

Gene name
pdxA
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase (4-(phosphohydroxy)-L-threonine dehydrogenase)
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
abs  Azospirillum brasilense Sp245
Brite
KEGG Orthology (KO) [BR:abs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AZOBR_p330020 (pdxA)
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     AZOBR_p330020 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     AZOBR_p330020 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Iso_dh
Motif
Other DBs
NCBI-ProteinID: CCD02619
UniProt: G8AXL0
Position
AZOBR_p3:complement(355581..356609)
Genome map
AA seq 342 aa AA seqDB search
MTPHLAITMGDPAGVGPEIIVKACARLKERLDAGSLRLLVIGSNPALMAAREALGSDLAF
PEVTADEEWPALACLQAGPEGEPIRPGELSVDGGRFAYLAVERAVRLAEAGRIHGLVTAP
LNKEAMNKAGYHFAGHTDLLAELTGARGSVMMLAHGNMRVSHVTTHIALEDVPKRLTPER
LRYVIDRTDETLAGLGLERRRIAIAALNPHAGEGGLFGRQDIEITTPVIERCVAEGLDVV
GPVPGDTVFVKLRAGQFDAVVAMYHDQGHIPVKLLGFHVDPATGRWDALSGVNITLGLPI
IRTSVDHGTAFDIAGKGIANELSLIEAIDYAEKLAAARRRTG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccccccatctggccatcaccatgggtgatccggccggcgtcggacccgagatcatc
gtcaaggcctgcgcccgcctgaaggagcggctggacgccggaagcctgcggcttctggtg
atcggcagcaacccggcgctgatggcggcgcgcgaggccttgggcagcgacctcgccttc
cccgaggtgacggcggacgaggagtggccggcgctcgcctgcctgcaggccggcccggag
ggcgaaccgatccgccccggcgagctgtcggtggacggcggccgcttcgcctatctggcg
gtggagcgcgcggtgcggctggccgaggccgggcgcatccatgggctggtcacggcgccg
ctgaacaaggaggcgatgaacaaggccggctaccacttcgccggccacaccgacctgctg
gccgagctgaccggtgcccgcgggtcggtgatgatgctggcccacggcaacatgcgggtc
agccacgtcaccacccacatcgcgctggaggacgtgccgaagcgcctgacgccggagcgg
ctgcgctacgtcatcgaccgcaccgacgagacgttggccgggctgggtctggagcgccgc
cgcatcgccatcgccgccctgaacccccacgctggggaaggcgggctgttcggccggcag
gacatcgagatcaccaccccggtcatcgagcgctgcgtggccgaggggctggacgtggtg
gggccggtgccgggcgacacggtcttcgtcaagctgcgcgccggccagttcgacgcggtg
gtcgccatgtaccacgaccagggacacattccggtcaagctgctgggcttccacgtcgat
ccggcgactggccggtgggacgcgctgagcggggtcaacatcacgctggggctgccgatc
atccgcacctccgtcgatcacggcaccgccttcgacatcgccggcaagggcatcgccaac
gagctgagcctgatcgaggccatcgattacgccgagaagctggccgccgcccgtcggcgg
accggctga

DBGET integrated database retrieval system