KEGG   Azospirillum brasilense Sp245: AZOBR_p330159Help
Entry
AZOBR_p330159     CDS       T02152                                 

Definition
(GenBank) cytochrome C
  KO
K08738  cytochrome c
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZOBR_p330159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CCD02758
UniProt: G8AXZ9
Position
AZOBR_p3:506908..507276
Genome map
AA seq 122 aa AA seqDB search
MKRMFALLAFGLVASSPGLAAAQDADAGAKVFNQCKACHTIEAGGPNRVGPNLHGVVGRK
AGAVETYKYSDAMKNAGAWDEATLDAYLADPKSAVPGNKMAFAGVKNEQARKDLIAYLKK
NS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcatgtttgccctgctcgccttcgggctggtcgcgtcgtcccccggcctcgcc
gccgcgcaggacgccgatgccggtgcgaaggtgttcaaccagtgcaaggcctgccacacc
atcgaagccggcggcccgaaccgcgtcggccccaacctgcatggcgtcgtcggccgcaag
gccggtgccgtcgaaacctacaagtattccgatgccatgaagaacgccggggcctgggac
gaggcgacgctcgacgcctatctggcggacccgaagagcgccgtccccggcaacaagatg
gccttcgccggcgtgaagaacgagcaggcccgcaaggacttgatcgcctatctgaaaaag
aacagctga

DBGET integrated database retrieval system