KEGG   Arcobacter butzleri ED-1: ABED_0274Help
Entry
ABED_0274         CDS       T01823                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
abt  Arcobacter butzleri ED-1
Pathway
abt00230  Purine metabolism
abt00240  Pyrimidine metabolism
abt01100  Metabolic pathways
abt01110  Biosynthesis of secondary metabolites
abt01130  Biosynthesis of antibiotics
Module
abt_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
abt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
abt_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:abt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ABED_0274
   00240 Pyrimidine metabolism
    ABED_0274
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:abt04131]
    ABED_0274
Enzymes [BR:abt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     ABED_0274
Membrane trafficking [BR:abt04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    ABED_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: BAK69991
UniProt: A0A0M1UKJ7
Position
274106..274519
Genome map
AA seq 137 aa AA seqDB search
MEQTLSIIKPDAVAKNVVGKILDRFESAGLKIAATKKLQLSQADAEAFYAVHAARPFFKD
LVEFMISGPVVVSVLEGENAMAKNRELMGATNPKEAAAGTIRADFADSIDANAVHGSDSL
ENAKNEIAFFFAQREIC
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacattatcaatcatcaaaccagatgcagttgcaaaaaatgtagttggtaaa
atcttagacagatttgaatcagctggattaaaaatagcagcaacaaaaaaattacaatta
agccaagcagatgctgaagctttttacgcagttcacgcagctagaccttttttcaaagat
ttagttgagttcatgatttcaggacctgttgtagtttcagttttagaaggtgaaaatgca
atggcaaaaaatagagaattaatgggtgcaacaaatcctaaagaagcagcagctggaaca
attagagcagatttcgctgattcaattgatgcaaatgcagttcatggttctgattcgtta
gaaaatgcaaaaaatgaaatagcttttttctttgcacaaagagaaatttgttaa

DBGET integrated database retrieval system