KEGG   Arcobacter butzleri ED-1: ABED_1107Help
Entry
ABED_1107         CDS       T01823                                 

Definition
(GenBank) putative uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
abt  Arcobacter butzleri ED-1
Pathway
abt00860  Porphyrin and chlorophyll metabolism
abt01100  Metabolic pathways
abt01110  Biosynthesis of secondary metabolites
abt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABED_1107
Enzymes [BR:abt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ABED_1107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: BAK70824
UniProt: A0A0M1UN36
Position
1132637..1133266
Genome map
AA seq 209 aa AA seqDB search
MKKIYLLNEQKHEDVENLEVFQIEYIKSDIDLKKYDALVFTSKNGVKAINSFNQDWKNIP
SYAIAQKTANTIMKLGGVIEFIGNSGHGNDFAYELKNVLKDKKVLYVKALKTVSNLPNIL
KENGISLDEIIAYKTSCKKSNIILEENSIFIFTSPSSVECFFKQYSWKNSYKAIVIGKTT
AEFLPSNINYEISSQTSVEECIKLAKQLS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatatttattaaatgaacaaaaacatgaagatgttgagaatttagaagtt
tttcaaatagagtatataaaatcagatattgatttaaaaaaatatgatgctttagttttt
acatcaaaaaatggtgtaaaagcaataaactcttttaatcaagattggaaaaatattcct
tcttatgcaatagctcaaaaaacagcaaatactataatgaaattgggtggagttattgaa
tttataggaaactctggacatggaaatgattttgcttatgaattaaaaaatgttttaaaa
gataaaaaagttttatatgttaaggctttaaaaacggtttcaaatttgccaaatatttta
aaagaaaatggtatttctttagatgaaataatcgcttataaaacttcttgtaaaaaatca
aatattattttagaagaaaattctatatttatattcacttctccttcaagcgttgaatgt
ttttttaaacaatattcgtggaagaattcatataaagctattgttattggaaaaactaca
gctgagtttttaccttcaaatataaattatgaaattagttctcaaacttcagttgaagag
tgtataaagttagctaaacaactctcttaa

DBGET integrated database retrieval system