KEGG   Arcobacter butzleri ED-1: ABED_1290Help
Entry
ABED_1290         CDS       T01823                                 

Definition
(GenBank) exodeoxyribonuclease V alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
abt  Arcobacter butzleri ED-1
Pathway
abt03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:abt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    ABED_1290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:abt03400]
    ABED_1290
Enzymes [BR:abt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ABED_1290
DNA repair and recombination proteins [BR:abt03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ABED_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 Viral_helicase1 SH3_13 HHH_5 PIF1 PhoH Mg_chelatase Ribosomal_S13 AAA AAA_16 UvrD_C AAA_5 AAA_12 AAA_22 5_3_exonuc ABC_tran
Motif
Other DBs
NCBI-ProteinID: BAK71007
UniProt: A0A0M1UPB5
Position
complement(1319745..1322072)
Genome map
AA seq 775 aa AA seqDB search
MQEEYKSFKLSGVIKKVLYKNDETKYIIAVLENNQKVCGTYFDTDIEKIVGEEVVLTGNW
TTHKKYGVQFEFDTLELKEAEMFFFLTKIVKGVGKKFASELLEKYSENELIEILNDRPNE
LLNFKGIKDKKLETIVASWHKFKHLRELGSFLGKFGVTSNLITKIYSTFGEVENLIEKIK
QNPYILINIKGIGFKRADEIAKSLGIDPKSEFRIMACLNYTLREFCDNNGNSSIDKFHLY
KLLDESLRFSNQELLYESAISKMLVDEELFVTSENRVALSMLYYAEKRILEFFNRRKDEK
NKKIIASFDEYLVKKQETLGFELSVEQKKAVELINSGEKTLFLIGYAGTGKSTSSRAILE
LLEEIMSYDDIMTIALSGIASQRISDTTGYNSSTIQSLLVKHKEKDFFPYKAILLDEASM
VNSVTFYQIISKIDDDTIFIIVGDDGQLPAIGAGNILADAIKYELAPICKLTKIYRQNEN
QAIAVIANDIRRGEIPSYKEDYEDFRFIDVSIANYYAMKNSVSSNDFADLRGENSEYILN
NILNISSTYIQDYYDFIKKKKISKALTLFQVITPMKGGVLGVDNLNIQLQKLFNHTKGKA
FASKIYEYKLTDKVIHIKNENMKAQTMSMYKSGLTDFLERRVYNGQLGLIIKLDFEEEKC
IVLYPNDDMVVFYDFENVHHLLSLAYCLTIHKTQGMEYDNALIPMSFSHYIMHNTKLLYT
AITRAKKMCFIVGEEEAFKSACKKLEITIRESVINDLLSKKEPKIELSNIEMITI
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagagtataaaagtttcaaattatcaggagttataaaaaaagttttatataaa
aatgatgaaacaaaatacataattgctgttttagaaaataatcaaaaagtttgtggaaca
tattttgatactgatattgaaaaaatagttggtgaagaggttgttttaactggaaattgg
actacacataaaaagtatggtgttcaatttgagtttgatactttagaactaaaagaagca
gaaatgttcttttttcttacaaagattgtaaaaggtgtaggaaaaaaatttgctagcgaa
cttttagaaaaatatagtgaaaatgaactaattgaaattttaaatgatagaccaaatgaa
cttttaaatttcaaaggtataaaagataaaaaactagaaactattgttgcatcttggcat
aagttcaaacatttaagagaacttggttcatttttaggaaaatttggggtaacttcaaac
ttaattacaaaaatatattcaacttttggtgaagttgaaaatttaatagaaaaaatcaaa
caaaatccatatatcttgataaatataaaaggaataggttttaaaagagctgatgaaata
gcaaaatctcttggaattgacccaaaatcagagtttagaataatggcttgtctaaactat
actttaagagagttttgcgataacaacggaaactcttcaatagacaaatttcatctatat
aaacttttagatgaaagtttgagattttcaaatcaagaacttttatatgaatcagcaatt
tcaaaaatgttagtagatgaagagctttttgttacaagtgaaaatagagttgcactttct
atgctttattatgcagaaaaaagaattttagagttttttaatagaagaaaagatgaaaag
aacaaaaaaattattgcttcttttgatgaatatttagttaaaaaacaagaaactttaggg
tttgaacttagtgttgagcaaaaaaaagcagttgaacttataaatagtggagaaaaaact
ctatttttgattggttacgctggtactggaaaatcaacttcaagtagggcgatattagaa
cttcttgaagagataatgagttatgatgatattatgactattgctttaagtggaatagca
agtcaaagaataagtgatacaacaggttataactcttcaactattcaaagtttacttgta
aaacataaagagaaagatttttttccttataaagctattttacttgatgaagcttctatg
gtaaattcagttactttttatcaaattatttcaaaaattgatgatgatactatttttata
atcgttggagatgatggacagcttcctgctattggagctggaaatattttagcagatgca
ataaaatatgaattagcacctatttgtaaacttacaaaaatttatagacaaaatgaaaat
caagcaatagcagttattgcaaatgatataagacgtggtgaaattccttcttataaagaa
gattacgaagattttaggtttattgatgtttcaatagcaaactattatgcaatgaaaaac
tctgtttcatcaaatgattttgcagatttaagaggtgaaaatagcgaatatattttaaat
aatattttaaatatctcttcaacttatatccaagattattatgattttataaaaaagaaa
aaaatatcaaaagctttgactctttttcaagtaattactccaatgaaaggaggagtttta
ggagttgataatctaaatattcaacttcaaaagctttttaatcacacaaaaggaaaagct
tttgcttcaaaaatttatgaatataaacttacagataaagtaattcatataaaaaatgag
aatatgaaagctcaaactatgagtatgtataaaagtggcttaacggattttttagaaaga
agagtttataacggacaattaggtcttataataaaacttgattttgaagaagaaaaatgt
atcgttttatatccaaatgatgatatggtagtattttatgattttgaaaatgttcatcat
cttttatctttggcttactgtttaactattcataaaactcaaggaatggagtatgataat
gcacttattcctatgagtttttctcactatattatgcataatacaaaactactttataca
gcaattacaagagcaaaaaaaatgtgttttattgttggagaagaagaggcttttaaaagt
gcttgtaaaaaactagaaattacaataagagaatcagtaataaatgatttattaagtaaa
aaagagccaaaaattgagttgtcaaatatcgaaatgattactatttaa

DBGET integrated database retrieval system