KEGG   Arcobacter butzleri ED-1: ABED_1610Help
Entry
ABED_1610         CDS       T01823                                 

Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
abt  Arcobacter butzleri ED-1
Pathway
abt00260  Glycine, serine and threonine metabolism
abt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abt01100  Metabolic pathways
abt01110  Biosynthesis of secondary metabolites
abt01130  Biosynthesis of antibiotics
abt01230  Biosynthesis of amino acids
Module
abt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABED_1610
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABED_1610
Enzymes [BR:abt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABED_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: BAK71327
UniProt: A0A0M1UQ62
Position
complement(1656346..1657086)
Genome map
AA seq 246 aa AA seqDB search
MKKLVGYITASLPNNSFTVDLAFTLKESGVDILELGVPFSDPVADGPVIEKANLKALNNG
FKLKDLFEISSKIGHNIDTLWMGYMNPFFHYGVENFLKKAQEYQINGTIIPDLPYEMAQK
FEPLFEKYEKANITFIAPTDSEDRVKLLVENSKKFIYMVAYTGITGSGQKEDLSLLINNV
RKYTNTPLYIGFGVDEKSCKEKAVGVDGVIVGSAFVKHLIDDSLSNSEKIKKISLVAKEI
KEKINE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaattagtaggttatattacagcatctcttccaaataatagttttacagttgat
ttggcctttactttaaaagaatctggagttgatattttagaactaggagttccattttca
gatccagttgctgatggaccagttattgaaaaagcaaatttaaaagctttaaataatggt
tttaaattaaaagatttatttgaaatatcttcaaaaattggacataatattgatacttta
tggatgggatatatgaatcctttctttcactatggtgttgaaaactttttaaaaaaagca
caagaatatcaaattaatggaacaataattccagacttaccatatgaaatggctcaaaaa
tttgagccattatttgaaaaatatgaaaaagcaaatattacttttattgcaccaacagat
agtgaagatagagtaaaacttttagtagaaaactcaaaaaaatttatttatatggtagca
tatactggaattacaggaagtggacaaaaagaagatttgtctttgcttataaataatgtc
agaaaatatacaaacacacctttatatattggctttggtgttgatgaaaaaagttgtaaa
gaaaaagctgttggtgtagatggtgtaattgttggaagtgcatttgttaaacatttaatt
gatgatagtttatcaaatagtgaaaaaattaaaaaaatttctcttgttgcaaaagagata
aaagaaaaaattaacgaataa

DBGET integrated database retrieval system