KEGG   Arcobacter butzleri RM4018: Abu_0586Help
Entry
Abu_0586          CDS       T00600                                 

Definition
(GenBank) HAM1-like protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
abu  Arcobacter butzleri RM4018
Pathway
abu00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:abu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Abu_0586
Enzymes [BR:abu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Abu_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ABV66853
UniProt: A8ESC9
Position
589501..590100
Genome map
AA seq 199 aa AA seqDB search
MKIVLASANKGKIKEFERLLPNDEIVAFSEILGKIEIDEDKDTFKGNAIKKAQTIYDELQ
KINFGDVVVISDDSGISVPVLGNAPGVYSARYAGLNASDKENNEKLKAELNKLGLEKTPA
FYTACIAIVYKNEVYTVHGWMYGEVLNKEIGTNGFGYDPMFIPNGYDKTLGELDEGVKKE
FSHRSKALKLAMKVLEVIL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcgttttagcctcagcaaataagggaaaaataaaagagttcgaaagacttctt
ccaaatgatgaaatagtagcatttagtgaaattttaggaaaaattgaaattgatgaagat
aaagatacttttaaaggtaacgctataaaaaaagcacaaacaatctatgatgaacttcaa
aaaattaattttggtgatgttgttgtgatttcagatgattcaggaattagtgtaccagtt
ttaggaaatgctccaggagtttatagtgctagatatgcaggacttaatgcaagtgataaa
gaaaataacgaaaaattaaaagctgaattaaataaattaggtttagaaaaaactcctgct
ttttatacagcttgtattgcaatagtttataaaaatgaagtttatacagttcatggttgg
atgtatggtgaagttttaaataaagagataggaacaaatggttttggatatgatcctatg
tttattccaaatggatatgataaaacgttaggtgaattagatgaaggagttaaaaaagag
ttttctcatagaagtaaagctttaaaacttgcaatgaaagttttagaagttattctttag

DBGET integrated database retrieval system