KEGG   Arcobacter butzleri RM4018: Abu_1219Help
Entry
Abu_1219          CDS       T00600                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-biphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
abu  Arcobacter butzleri RM4018
Pathway
abu00010  Glycolysis / Gluconeogenesis
abu00030  Pentose phosphate pathway
abu00051  Fructose and mannose metabolism
abu00680  Methane metabolism
abu01100  Metabolic pathways
abu01110  Biosynthesis of secondary metabolites
abu01120  Microbial metabolism in diverse environments
abu01130  Biosynthesis of antibiotics
abu01200  Carbon metabolism
Module
abu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Abu_1219 (fbp)
   00030 Pentose phosphate pathway
    Abu_1219 (fbp)
   00051 Fructose and mannose metabolism
    Abu_1219 (fbp)
  09102 Energy metabolism
   00680 Methane metabolism
    Abu_1219 (fbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abu04147]
    Abu_1219 (fbp)
Enzymes [BR:abu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Abu_1219 (fbp)
Exosome [BR:abu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Abu_1219 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: ABV67479
UniProt: A8EU55
Position
1224450..1225292
Genome map
AA seq 280 aa AA seqDB search
MQEIMKAIEESAIKIKHLIETGDTGKSEFENSTGDTQLKLDIASDKIIEDIFKNIPSIKA
IVSEEQEAIVNLHENGKYLIAYDPLDGSSLVDVNLSVGSIFGIYENEFNAQNIVASVYVV
FGPRVEMVVTTTDVKMYRLLDGKFTFIQNIKLNEKGKLNAPGSTQNCWAPFHKQLIDDIF
NDGYRLRYSGGMVPDLHQILLKGGGLFSYPGTSDKPKGKLRQLFEVFPFALAYEKAGGQA
VDGFKRVLEVQTTHIHDTTPCFFGSNSEINRVLEVYKKNV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaataatgaaagcaatagaagaatcagcaataaaaatcaaacatttaatagaa
actggtgatacaggcaaaagtgaatttgaaaattcaactggagatactcaattaaaactt
gatattgcaagtgacaaaattattgaggatatttttaaaaatattccaagtatcaaagca
attgtgagtgaagaacaagaagctattgtaaatttacatgaaaatggtaaatatttaatt
gcttatgatccacttgatggttcatctttagttgatgtaaacctatctgttggttcaatt
tttggtatttatgaaaatgaatttaatgcacaaaatatagttgcttcagtttatgtagtt
tttggtccaagagttgaaatggtagtaactacaactgatgtaaaaatgtatagattatta
gatggtaaatttacttttattcaaaatattaagcttaatgaaaaaggtaaattaaatgct
cctggttctacacaaaattgttgggcaccttttcataaacagttaattgatgacattttt
aatgatggttatagattaagatatagtggaggaatggttccagatttacaccaaatttta
ttaaaaggtggtggacttttttcatatccaggaacaagtgataaaccaaaaggaaaatta
agacagttatttgaagttttcccttttgcattagcttatgaaaaagctggtggtcaagct
gttgatggatttaaaagagttttagaagtgcaaactacacatattcacgatacaactcct
tgcttttttggctcaaatagcgaaataaatagagttttagaagtttataaaaaaaatgtc
tga

DBGET integrated database retrieval system