KEGG   Arcobacter butzleri RM4018: Abu_1228Help
Entry
Abu_1228          CDS       T00600                                 

Gene name
ribAB
Definition
(GenBank) bifunctional GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
abu  Arcobacter butzleri RM4018
Pathway
abu00740  Riboflavin metabolism
abu00790  Folate biosynthesis
abu01100  Metabolic pathways
abu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Abu_1228 (ribAB)
   00790 Folate biosynthesis
    Abu_1228 (ribAB)
Enzymes [BR:abu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Abu_1228 (ribAB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Abu_1228 (ribAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ABV67488
UniProt: A8EU64
Position
complement(1233243..1234274)
Genome map
AA seq 343 aa AA seqDB search
MNAIKRVQEAIKEIQKGNMVIMLDDEDRENEGDLVYSAALSTPDMVNFMVTHAKGLVCVS
LPKETADRLELNPMVTSNTSSYETAFTVSVDAASAATGISAIERDDTIKILANPISRTNE
LVRPGHIFPLIAKDGGVLVRTGHTEGSVDLCKLAGLNGEAVICEILKEDGTMARRDDLDI
FALKHNLKQVYISDLVEYRLSHEKLVEEISSANKKFFSKDVIQKEFKDHLGNIHTAIIFG
EIKEISHIKFHTIRPDIKMFLNDDKLHSMLKTINFMQSKGGILIFLNNGRKNSELEKNYG
IGAQILNSLNIKQIKLMTSGGKHSFVGLQGFGLEIVEEIQIEG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaataaaaagagtacaagaagctataaaagagattcaaaaaggtaatatggta
ataatgcttgatgatgaagacagagaaaatgaaggtgatttagtttattctgctgcatta
agtacgccagatatggtaaattttatggtaacacatgcaaaaggattagtttgtgtttct
ttaccaaaagaaacagcagatagattagagttaaatcctatggttacatcaaatacatct
tcttatgaaacagcatttacagtttcagttgatgcagcaagtgcagctactggaattagt
gcaattgagagagatgatactataaaaatattagcaaatcctatttcaagaacaaatgaa
ttagtaagaccaggtcatatttttcctttgattgcaaaagatggaggagtattagttaga
acaggtcatacagaaggaagtgttgatttatgtaaacttgcaggtttaaatggtgaggct
gttatttgtgaaattttaaaagaagatggaacaatggcaagacgagatgatttagatatt
tttgcattaaaacataatttaaaacaagtatatatttctgatttagttgagtatagatta
tctcatgaaaaacttgttgaagagatttcaagtgcaaataaaaaattcttttcaaaagat
gtaatacaaaaagagtttaaagatcatttaggaaatattcatacagcaattatttttggt
gaaataaaagagataagtcatataaaatttcatacaattagaccagatataaaaatgttt
ttaaatgatgataaattacattcaatgctaaaaacaataaactttatgcaatcaaagggt
ggaattttgatatttctaaataatgggcgaaaaaatagtgagttagaaaaaaactatgga
ataggggctcaaattttaaactctttaaatataaaacaaattaaacttatgacaagtgga
ggaaaacactcttttgttggtttacaaggctttgggttagaaatagtagaagagatacaa
atagaaggttaa

DBGET integrated database retrieval system