KEGG   Arcobacter butzleri RM4018: Abu_1473Help
Entry
Abu_1473          CDS       T00600                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abu  Arcobacter butzleri RM4018
Pathway
abu00010  Glycolysis / Gluconeogenesis
abu00020  Citrate cycle (TCA cycle)
abu00620  Pyruvate metabolism
abu01100  Metabolic pathways
abu01110  Biosynthesis of secondary metabolites
abu01120  Microbial metabolism in diverse environments
abu01130  Biosynthesis of antibiotics
abu01200  Carbon metabolism
Module
abu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Abu_1473 (aceF)
   00020 Citrate cycle (TCA cycle)
    Abu_1473 (aceF)
   00620 Pyruvate metabolism
    Abu_1473 (aceF)
Enzymes [BR:abu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Abu_1473 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3 PTS_EIIA_1 RnfC_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ABV67728
UniProt: A8EUV4
Position
1478527..1480182
Genome map
AA seq 551 aa AA seqDB search
MAKVYDIFIPDLGADKDVDLIDIMVKVGDKVEVEDGLITLETEKASMDVPTTHAGIIKEI
LVKVGDKANSGDLIARVEAQDDSSADEPKVEVATPAKVEEPKEEVVAVQTPTQFVKEQTI
KSVVEEVRVPDLGAEKDVDLIDVMIHVGDVIVKDYSIITLETEKASMDVPAPFGGEVIEI
FVEKGQKINSGDLIAKVIKSVVIEDKVPTPTFAANTTPTKVEKVASSTPTIQEVAAISIE
KEDSKVLSKKATKVYASPSVRKIAREFGVDLGFVKGSGEKGRILKDDIKAYVKEQLNKPA
TASNIGFGFNLPESKEIDFSVFGNVERVELSRVQKVSGPFLHKNYLSMPHVTQFDEADIT
ELEEFRKAQNNIAKDFKLSPLVFIIKAVQKALQIHPKFNSSLSSDGQELIMKKYFNIGVA
VDTPNGLLVPVIKDVDKKGFKDIAIELAELSKKARDGKLTSADMSGGCFTISSLGGIGGT
YFTPIINAPEVAILGVSKSSIKPVFDGKEFKPKLILPLSLSYDHKVIDGADGARFTTTLS
QLLSDIRLLSL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtttatgatatttttattcctgatttaggtgctgataaagatgttgactta
atcgatattatggttaaagttggagataaagtagaagttgaagatggacttataacttta
gaaacagaaaaagcttctatggatgttcctacaactcatgctggaattatcaaagaaatt
ttagtaaaagttggtgacaaagcaaatagtggtgatttaatcgctagagttgaagcacaa
gatgactcaagtgctgatgaaccaaaagttgaagttgcaacacctgcaaaagttgaagaa
ccaaaagaagaagttgttgctgttcaaactccaacacaatttgtaaaagaacaaactata
aaatctgttgttgaagaagtaagagtacctgatttaggagcagaaaaagatgttgattta
atcgatgttatgattcatgttggtgatgttatagtaaaagactatagtattatcacactt
gaaacagaaaaagcttctatggatgttcctgcaccatttggtggagaagttattgaaatt
tttgtagaaaaaggacaaaaaatcaatagtggagatttaatagcaaaagttataaaaagt
gttgttattgaagataaagttccaactcctacatttgctgcaaatacaactcctacaaaa
gtagaaaaagtagcaagttctactcctacaatccaagaagtagcagctattagcattgaa
aaagaagatagtaaagttttatctaaaaaagctactaaagtttatgcttcaccaagtgta
agaaaaatagcaagagaatttggtgttgatttaggatttgtaaaaggaagtggtgaaaaa
ggaagaatcttaaaagatgatattaaagcttatgtaaaagagcagttaaataaacctgct
actgcttcaaatattggttttggatttaacttacctgaatcaaaagagatagacttttct
gtatttggtaacgttgaaagagttgaactaagtcgtgttcaaaaagtttctggaccattt
ttacataaaaactatttatctatgcctcacgttacacaatttgatgaagctgatattaca
gaacttgaagagtttagaaaagcacaaaataatatcgctaaagatttcaaactatctcct
ttagtatttattataaaagctgttcaaaaagctttacaaattcatccaaaattcaactca
agtttaagtagtgatggacaagagttaattatgaaaaaatactttaatattggagttgct
gttgatacaccaaatggtttattagttccagtaattaaagatgttgataaaaaaggtttc
aaagatattgctattgaattagctgaactttcaaaaaaagcaagagatggaaaattaaca
agtgcagatatgagtggtggatgcttcactatttcaagccttggtggaattggtggaaca
tacttcacgccaattataaatgctccagaagttgcaattttaggtgtttcaaaatcttct
attaaacctgtatttgatggtaaagaatttaagccaaaattaattttacctctaagttta
tcttatgatcacaaagtaattgatggtgcagatggtgctagatttactactactttatca
caacttttaagtgatattagattactaagcttataa

DBGET integrated database retrieval system