KEGG   Arcobacter butzleri RM4018: Abu_1489Help
Entry
Abu_1489          CDS       T00600                                 

Definition
(GenBank) HMGL family protein
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
abu  Arcobacter butzleri RM4018
Pathway
abu00360  Phenylalanine metabolism
abu00362  Benzoate degradation
abu00621  Dioxin degradation
abu00622  Xylene degradation
abu01100  Metabolic pathways
abu01120  Microbial metabolism in diverse environments
abu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Abu_1489
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Abu_1489
   00622 Xylene degradation
    Abu_1489
   00621 Dioxin degradation
    Abu_1489
Enzymes [BR:abu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Abu_1489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like Glyco_hydro_53
Motif
Other DBs
NCBI-ProteinID: ABV67744
UniProt: A8EUX0
Position
1498111..1499079
Genome map
AA seq 322 aa AA seqDB search
MIEKKGSILSVREDIKVFDCTIRDGGLVNNYHFSDEFVKAHYETCLAAGVDYMEIGKNVS
PTIMSEAEYGPWNFCKEEDIRRIVGENKTNMKIAVMSDIGRSLKEELRPKSESVVDMIRI
ATYIHQIPAAIELIEDAHAKGYETTVNIMAISKSFDDELDEVLEQLSKTNVDVIYIADSF
GSFYPEQIKKLTEKYLSFAQKTGKKVGIHAHNNLQLAYANTLEAMIYGTSFLDVTISGLG
RGAGNCPLELLIGFLKNPKYKLTPVLKFIEEYIVPLEKELDWGYSIPYMITGQLNEHPRA
AMKARDEKDTKYREFYKSLTIE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaaaaaaaggttcaattctatcagttagagaagatataaaagtttttgattgt
actattagagatggtggattggtaaataactatcactttagcgacgaatttgtaaaagca
cattatgaaacttgtcttgcagctggtgttgattatatggaaattgggaaaaatgtatct
ccaactattatgagtgaagctgaatatggtccttggaatttctgtaaagaagaagatata
agaagaattgttggtgaaaataaaacaaatatgaaaatcgctgttatgagtgatattgga
agaagtttaaaagaagaacttagaccaaaaagtgaaagtgtagttgatatgataagaata
gcaacttatattcaccaaatccctgcagctattgaactaatcgaagatgcacatgcaaaa
ggttatgaaacaacagtaaatatcatggctatttcaaaatcttttgatgatgaacttgat
gaagttttagagcaactatctaaaacaaatgttgatgttatttatatagctgatagtttt
ggttctttttatcctgaacaaatcaaaaaattaactgaaaaatatctaagttttgcacaa
aaaactggtaaaaaagtaggtattcatgcacataacaatcttcaattagcttatgcaaat
actttagaagctatgatttatggtacaagtttccttgatgttacaatctcaggattagga
agaggtgcaggaaattgtccacttgaacttttaattggttttttaaaaaatccaaaatat
aaactaactcctgttttaaaatttattgaagagtatatcgtaccacttgaaaaagaactt
gattggggatatagtattccttatatgataactggtcaactaaatgaacatccaagagct
gctatgaaagcaagagatgaaaaagatactaaatatagagaattttataaaagtttaact
atcgaataa

DBGET integrated database retrieval system