KEGG   Arcobacter butzleri RM4018: Abu_2331Help
Entry
Abu_2331          CDS       T00600                                 

Gene name
glsA
Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
abu  Arcobacter butzleri RM4018
Pathway
abu00220  Arginine biosynthesis
abu00250  Alanine, aspartate and glutamate metabolism
abu00471  D-Glutamine and D-glutamate metabolism
abu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Abu_2331 (glsA)
   00220 Arginine biosynthesis
    Abu_2331 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Abu_2331 (glsA)
Enzymes [BR:abu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Abu_2331 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase DUF4781
Motif
Other DBs
NCBI-ProteinID: ABV68539
UniProt: A8EX66
Position
2337847..2338764
Genome map
AA seq 305 aa AA seqDB search
MNYQTILEEIEKEIQALFVEGKVASYIPALANVNPNQFSMAIKMFDGQTFGVGEIDKKFS
IQSISKVFTFTLALNYYGKELYKRVSHEPSGNPFNSLVQLEYENGIPRNPFINAGAIVTA
DTLVSIYKNDTFNQILDFIKMVSNDKTIDFNEEIFHSELEHGFRNYALINMIKSFGNIHN
DIDEVIKTYFKQCSIMMSPSQLASSMLFLANHGINPITNERILTESKAKRISSLMLTCGH
YDASGDFAYKVGLPGKSGVGGGIVAIVPKKMAICVYSPKLNTQGNSLIGTKALELFTTKT
GLSIF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaaactattttagaagagattgaaaaagagattcaagctctttttgttgaa
ggaaaagttgctagttatattccagctcttgcaaatgtaaatcctaatcaattttctatg
gcaatcaaaatgtttgatggtcaaacttttggagttggagagatagataaaaaattctcc
atacaaagcatttcaaaagtttttacatttacattggctttaaactattatggaaaagag
ttatataaaagagttagtcatgaaccatcgggaaatccttttaattcactagttcaactt
gaatatgaaaatggaattccaagaaatccatttataaatgctggtgcgatagtaacagct
gatactttggtttctatttataaaaatgacacttttaatcaaatcttagattttattaaa
atggtttcaaatgataaaaccatagattttaatgaagagatttttcactctgagctagaa
catggattcagaaactacgcgctaataaatatgattaaaagttttggaaatattcacaat
gatattgacgaagttataaaaacatattttaaacaatgttctattatgatgagcccgtct
caacttgcaagttcaatgctttttttggcaaatcatggaataaatccaataacaaatgaa
agaattctcactgaatcaaaagcaaaaagaataagttcacttatgcttacttgcggtcat
tatgatgcaagtggagattttgcttataaagttggacttcctggaaaaagcggtgttgga
ggaggaattgtcgcaattgttcctaaaaaaatggcaatttgtgtatattctccaaaacta
aatactcaaggaaattcactaattggaacaaaagctctagaattatttactacaaaaact
ggtctatcaattttttaa

DBGET integrated database retrieval system