KEGG   Aminipila butyrica: Ami103574_00575
Entry
Ami103574_00575   CDS       T06474                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
abut  Aminipila butyrica
Pathway
abut00472  D-Arginine and D-ornithine metabolism
abut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abut00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Ami103574_00575
Enzymes [BR:abut01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Ami103574_00575
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: QIB67892
Position
complement(121263..123473)
AA seq 736 aa
MTELKRNEKLDVESILKDLDKYEPKRRGWHWRTPAPGIKMGPFEYKDCSEPLKNSVGLPP
AKFFEDIDPQPLPVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRHMGQSHIDGLMEGT
PQGIGGVPITRKQVRAQRKALDIIEEEVGRPINYHSYVSGVAGPDVAVMFAEEGINGAHQ
DPQYNILYRDINCVRSFVDACESKKIMAWAGMLQIDGAHNANATAREAWKVMPELIVQHA
INSLFSEKVGISPDLISLSTVPPTATPAPAVYMDLPYAVALRDICGRYKMRAQQNTKYIC
SSAREATVTHVLNMLISKLTSADIQSTITPDEGRNVPWHIYNIEACDNAKQTLIGLDGLM
DMVELKNDGPLREIARDLKERACLFMEEIIEVGGYFQAVQEGFFVDSAKYPAKNGDGIAR
KIEGGIGYGFIFERAEDYMAPVTAHFGYNNVTQYGGNPEDPAALIGGCTFEDRSKIVYID
ELDEDDTVNVRLAKVKKYRDGEALKPEVEWCGDGTILLTMCIPANVRVAEAAALEIGRKM
GLENPEVISKEILQEAEGTRIEMKGRVGFDIDPSILVLPPEPHYLSDAVLYKEFSDHPMK
VVCGTVGEDEHSVGLREIINIKHGGIEKWGIEVEYLGTSVPVEKLVDAAVELNADAILAS
TIISHDNVHYKNMKRINELAIEKGIRDKVIIAAGGTQVVPEEARKTGIDEGFGRDSHGVD
VATFLAEEAMRRRGDL
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgacagaattgaagcgtaatgaaaaattagatgttgaaagcatcttgaaagacctagat
aagtacgagccaaaaagaagaggctggcactggagaacacctgctcctggcattaagatg
ggtccttttgaatataaggattgctctgagccgttgaagaacagcgttggtcttcctcct
gctaaattctttgaagatatcgatccacagccgctgccggttatcactacagaaatcgct
tctggaagatttgaagatgacatcagaagaatgagaatggccgcatggcacggtgcagac
catatcatggttatccgtcatatgggtcagtctcacatcgacggactgatggaaggtact
ccacagggtatcggtggtgttcctattactagaaagcaagtaagagcacagcgaaaggct
ctggatatcatcgaagaagaagtaggccgtccaattaactaccattcctatgtatctggc
gtagctggtccagacgtagcggttatgtttgcggaagaaggcatcaacggtgctcaccag
gatccgcagtacaacattttatacagagacatcaactgtgttcggtcctttgtagatgct
tgcgaatccaagaagattatggcttgggctggcatgctccagattgacggtgcgcacaat
gctaacgcaacagctagagaagcgtggaaggtaatgccggagctgatcgtacagcacgcc
attaactccctgttctccgaaaaggtaggcattagccctgatttaatcagcttgtccacc
gtaccgccgacagctacaccggcaccggctgtatacatggacctgccgtatgcagttgct
ctgagagacatctgcggcagatataagatgagagcacagcagaacacgaaatacatctgc
tcctccgcaagagaagctactgttactcatgtgcttaacatgctgatctccaagctgacc
agtgcagacattcagtccactatcacaccagacgaaggaagaaacgttccttggcacatc
tacaacattgaagcctgcgacaacgcaaagcagactctgatcggcttagatggtttaatg
gatatggtagagctgaagaacgatggtccattgagagaaatcgcgagagacttaaaagaa
agagcttgcctgttcatggaagaaatcatcgaagtaggtggatacttccaggctgtacag
gaaggattcttcgtagactctgctaagtacccagctaaaaacggcgacggtattgccaga
aagatcgaaggcggtatcggctatggctttatcttcgagcgtgcagaagactatatggct
cctgtaactgctcacttcggttataacaacgtaacccagtatggcggaaatccagaagat
ccggctgcgcttattggcggctgtacttttgaagacagaagcaaaatcgtatacatcgat
gaactggatgaagacgatactgtaaacgtacgtcttgccaaagtgaagaagtatcgtgac
ggcgaagcccttaagccagaagtcgagtggtgtggagacggaacaatcctgctgaccatg
tgcattcctgccaatgtaagagtagcagaagctgctgctttggaaatcggcagaaagatg
gggctggaaaatccagaagtaatcagtaaggaaattctacaggaagcagaaggtacaaga
atcgaaatgaagggccgtgttggcttcgatatcgatccttctatcctggtactgcctcca
gaaccgcattatttgagcgatgctgttttatacaaggagttcagcgatcacccaatgaag
gtggtttgcggtacagtaggtgaagatgaacactctgtaggccttcgtgagattattaac
attaagcatggcggtattgagaagtggggcatcgaggtagaataccttggaacttccgtt
ccggtagaaaagctggtagacgcagcagtagagctgaatgcagacgccatcctggcttcc
accatcatttctcacgacaacgtgcactacaagaatatgaagagaatcaatgaactggct
atcgaaaaaggcattcgcgataaggttatcatcgctgccggcggtacgcaggtagttcct
gaggaagctcggaagacaggcattgatgaaggtttcggcagagactctcacggtgtcgat
gtggctaccttcttagcagaagaagctatgagacgcagaggcgatctgtaa

DBGET integrated database retrieval system