KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT189362Help
Entry
AGABI2DRAFT189362 CDS       T03140                                 

Gene name
AGABI2DRAFT_189362
Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00480  Glutathione metabolism
abv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AGABI2DRAFT189362 (AGABI2DRAFT_189362)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abv02000]
    AGABI2DRAFT189362 (AGABI2DRAFT_189362)
Enzymes [BR:abv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AGABI2DRAFT189362 (AGABI2DRAFT_189362)
Transporters [BR:abv02000]
 Other transporters
  Pores ion channels [TC:1]
   AGABI2DRAFT189362 (AGABI2DRAFT_189362)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 18081099
NCBI-ProteinID: XP_006454035
JGI: Agabi_varbisH97_2_189362
Position
Unknown
AA seq 157 aa AA seqDB search
MSVTIQLPEGFQYVGSAIFSTAALLIWHTFLVGKYRKRAGIKYPQAYAEKAEVEASNDAH
LFNCAQRTHQNTLEHIPIIWATTLIVGSQMPVLAASVCGLWSLSRVTYTLGYLSGDPAKR
ISPLYKVSGIASLGVTAGAAYYAGLWVWQGVSAKFGI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttactatccaactccccgaaggctttcaatatgtcggatctgctatcttctcc
actgctgcgctcttaatatggcacacttttcttgttggaaagtatagaaagcgcgctgga
attaaatatcctcaagcgtatgccgagaaggctgaagttgaggccagtaatgatgcgcac
ctcttcaactgtgctcaacgtactcatcaaaacactctggagcatattcctatcatttgg
gcaaccactttgatagttggctcccagatgcctgtcctcgctgcttcagtctgtggcttg
tggtctttgtcccgcgttacctatacccttggatatcttagtggtgatcctgcaaaacga
atttcacctctctacaaagtttcgggtatagcttctctcggcgtcacagctggcgctgca
tactatgccggtctttgggtctggcagggagtctctgcgaaattcggtatctaa

DBGET integrated database retrieval system