KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT189464Help
Entry
AGABI2DRAFT189464 CDS       T03140                                 

Gene name
AGABI2DRAFT_189464
Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:abv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    AGABI2DRAFT189464 (AGABI2DRAFT_189464)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:abv03041]
    AGABI2DRAFT189464 (AGABI2DRAFT_189464)
Enzymes [BR:abv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     AGABI2DRAFT189464 (AGABI2DRAFT_189464)
Spliceosome [BR:abv03041]
 Complex C
  Other components
   Step II factors
    AGABI2DRAFT189464 (AGABI2DRAFT_189464)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 T2SSE ABC_tran AAA_30 AAA_19 DUF2075 PhoH
Motif
Other DBs
NCBI-GeneID: 18081139
NCBI-ProteinID: XP_006454167
JGI: Agabi_varbisH97_2_189464
Position
Unknown
AA seq 985 aa AA seqDB search
MRGRSYDNHRERADGARSLDERPVLYKIYSGKVVGLKDFGAFVALDGVAGRAEGLVHVSS
IQAGARANSANDLLSRNQPVKVKVLGVAGTRISLSMKDVDQLTGRDLTPYLRIRSEAELE
EERARTVHVSSGANNVSLRSKDEAPVRSAKRLTSPERWELKQLISSGQLDASEYPDLNEE
VNNPMAHAEVEEELDIEIREDEPPFLAGQTKRSLELSPVKIVKAPDGSLNRAALNGASLA
KERREMRQQEANEEADSQARDFSQPWLDPMSKDSDKMFAQDLRGSLKSQKVGEVPKWKEQ
SFNKATTFGEITNLSIQDQRKSLPIYKLRNQLLQAIGDHQVLIVVGDTGSGKTTQMVQYM
AEEGYADKGRIGCTQPRRVAAMSVAKRVSEEVGCRLGQEVGYTIRFEDCTSPETRIKYMT
DGMLQRECLIDPLCSSYSVIMLDEAHERTIATDVLFGLLKKAVKRRPDLKLIVTSATLDA
EKFSKYFYGCPIFTIPGRAYPVEMLYTKDPENDYLDASLITVMQIHLSEPPGDVLLFLTG
QEEIDTACEILFERMKALGPKVPELIILPIYSALPSEVQSRVFEPTPPGARKVVIATNVA
ETSLTIPGIYYVVDPGFSKQNAYDPRLGMDSLVVMPISQAQARQRAGRAGRTGPGKCYRL
YTEAAYRNEMLPNSIPDIQRTNLSSTILQLKAMGINDLLSFDFMDPPPSQTMLTALENLY
ALSALDDEGLLTRLGRKMADFPMEPPLAKMVIASVDLGCSEDILSIVAMLSVQTVFYRPK
EKQSQADSKKAKFHQPEGDHLTLLTVYNGWKAANFSNPWCYENFIQARSMRRAQDVRKQL
LGIMDRYKHDVVSAGRDYNRVRQAICSGFFRHAAKKDPSEGYKTLAEGTPVYIHPSSALF
NRNPEWLVYHELILTTREYCHNVTVIEPKWLVEFAPQCFKVADANKISKRKKQETIEPLF
NKYEKPDEWRLSKVRRSARSSQTFG
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggtagaagctatgacaaccatcgtgaacgtgccgatggtgctcgttctctggac
gaacggccagttttgtacaagatttatagtgggaaagtagttggcttgaaggatttcggg
gcctttgttgcactagatggtgttgccgggcgagccgagggtttggttcacgtttcaagt
atccaggctggcgccagagctaattctgccaatgatctactcagccgtaatcaacccgtc
aaagtcaaagtattgggcgtggccggtaccagaatcagcctctccatgaaggacgtcgat
cagttgacggggcgcgatctcacgccttaccttcgcatccggtcagaggcagagcttgaa
gaagagcgagctcgtacggtccatgtgtcatcaggggcgaacaatgtttctttgcggtca
aaggatgaagcccctgtcaggtccgccaagcggctcacatctcctgaacgttgggagctc
aaacaactcatatcgtccggtcaactcgatgcgtcagagtaccctgaccttaacgaggaa
gttaataaccctatggcacatgctgaagtagaggaggaattagatatcgaaatccgggag
gatgagcctcccttcctggcgggacaaactaagcgcagtcttgaacttagtccagtgaag
attgtcaaagcaccggatggctcgctcaacagagctgcactcaatggtgcgtctttggca
aaggagcgccgtgaaatgcgacaacaggaagcgaatgaagaggctgattctcaggcacga
gacttcagccagccttggctagatcctatgtccaaggattcggacaaaatgtttgcgcag
gatcttcgcggaagcttaaagagccaaaaggtgggggaagtgccaaaatggaaagagcaa
agttttaataaggcaacaacctttggcgaaatcacaaatctcagtatacaagatcaacga
aaaagcttacccatttataagcttcgcaatcagctattacaagctattggagatcatcaa
gttttgatcgtcgttggtgatacaggttcaggaaaaacaactcagatggttcaatacatg
gccgaagaaggttatgctgacaagggaaggatcgggtgcacgcagccgcgtcgtgtcgcc
gcaatgtctgttgcgaaacgtgtttcagaggaagtgggttgtcgtcttggacaagaagtt
ggctataccatccgttttgaggattgtaccagcccagaaactcgtatcaagtacatgacc
gacggtatgctacagcgtgaatgtttgatcgacccgctctgtagcagttactcggtcatt
atgttggatgaagctcacgaacggacgattgctactgatgtgctatttggactgcttaaa
aaggccgttaaacgtcgccccgatctcaagctcattgtaacatcggcaactctcgatgct
gagaagttttccaagtatttctacggctgcccaatcttcactattcctggacgagcttat
ccggtcgaaatgctatacactaaggatccggaaaatgactatcttgatgcgtccttgatc
accgtcatgcagattcacctttctgaaccccctggtgacgtactattattccttaccggc
caagaagaaatcgacacagcttgcgagattctattcgagcggatgaaggctctaggtccc
aaagtccctgaacttatcatcctacctatctattcggccttaccttcggaagtgcagtcg
cgggtcttcgagcccactccgcctggtgctcgtaaggtcgtcatcgcgaccaacgtcgct
gagacaagtttgaccatcccaggtatctattatgtcgtggacccaggcttctcgaagcag
aatgcttatgacccccgcttgggtatggactcgcttgttgtcatgcctatctctcaagcg
caagcccgccagcgggctggtcgcgccggtcgcacaggacctggaaaatgctatcgtctc
tatacggaagccgcctacaggaatgagatgctccccaactccatccctgacatccagcgc
actaacctttcatcaaccatcctacaactcaaagcaatgggtatcaacgacctgttgagc
ttcgattttatggatccacctccctcccagacgatgttaacagctttagagaatctgtat
gctttgtctgcgctggatgatgaaggtctgctgacgcgtcttggccgtaaaatggcggat
ttccccatggaaccgcctcttgcaaaaatggtcatagcatcagttgatctgggttgctcg
gaggacatcttatctatcgtcgcaatgctgtcagtccagaccgtgttttaccgtcccaaa
gagaagcagtcacaggctgattccaagaaggcgaaattccatcaacccgagggggatcac
cttacgcttttgacagtctacaatggttggaaagccgccaacttctcgaatccttggtgt
tatgagaattttattcaagcaagaagtatgcgacgggcacaggatgttaggaaacagtta
cttggaatcatggatagatacaaacatgatgttgtttccgctgggcgagattataaccgt
gttcgccaagctatttgctcaggtttcttccggcatgccgccaaaaaagatccctcagaa
ggctacaaaacacttgctgagggaacaccagtgtacattcacccatcctccgcattattc
aacaggaatccggagtggttggtgtatcacgaactaatcttaaccacgcgcgagtattgt
cacaatgtgacggtgattgaaccgaagtggctggtagaatttgctccgcagtgtttcaaa
gttgcagatgccaacaagatcagcaagcgaaagaaacaagagacgatagagcccttgttc
aacaagtatgagaagccggacgaatggcggttgtcgaaagtcaggaggagtgcaagatcg
tctcaaacgttcggatga

DBGET integrated database retrieval system