KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT190219Help
Entry
AGABI2DRAFT190219 CDS       T03140                                 

Gene name
AGABI2DRAFT_190219
Definition
(RefSeq) hypothetical protein
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:abv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    AGABI2DRAFT190219 (AGABI2DRAFT_190219)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:abv03041]
    AGABI2DRAFT190219 (AGABI2DRAFT_190219)
   03110 Chaperones and folding catalysts [BR:abv03110]
    AGABI2DRAFT190219 (AGABI2DRAFT_190219)
Enzymes [BR:abv01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AGABI2DRAFT190219 (AGABI2DRAFT_190219)
Spliceosome [BR:abv03041]
 Complex B
  Other components
   Prp19-related factors
    AGABI2DRAFT190219 (AGABI2DRAFT_190219)
 Complex C
    AGABI2DRAFT190219 (AGABI2DRAFT_190219)
Chaperones and folding catalysts [BR:abv03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    AGABI2DRAFT190219 (AGABI2DRAFT_190219)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 18081395
NCBI-ProteinID: XP_006457810
JGI: Agabi_varbisH97_2_190219
Position
Unknown
AA seq 158 aa AA seqDB search
MAAAESVVLETSMGDIQFELYWNHAPKTCKNFAELAKKGYYNGVIFHRIISDFMIQGGDP
TGTGRGGTSIYGQKFEDEIHPELRFTGAGILAMANSGPNTNGSQFFISLAPTPYLDNKHT
IFGRVSSGMQVVQRLGSVATDAQDKPREDVKIHKARTI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcagaatctgttgtccttgagaccagtatgggtgacatccagtttgagctc
tattggaatcatgcaccaaagacatgtaaaaacttcgccgagctcgcaaagaaaggatat
tacaatggtgtcattttccatcgcataatctctgatttcatgattcaaggcggagatcct
actggaactgggagaggaggaaccagcatatacggacaaaagtttgaagatgaaattcac
ccggaacttaggtttactggagcaggaattctcgcaatggcaaactcaggtcctaatacg
aatggatctcagttttttataagcttggctccgacaccttaccttgacaacaaacacaca
atctttggtcgagtcagctctggtatgcaagtggtacagagattaggatctgtcgccact
gacgcgcaggacaagcctcgagaagacgtcaaaattcataaagcacgaaccatataa

DBGET integrated database retrieval system