KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT190399Help
Entry
AGABI2DRAFT190399 CDS       T03140                                 

Gene name
AGABI2DRAFT_190399
Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00220  Arginine biosynthesis
abv00330  Arginine and proline metabolism
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
abv01130  Biosynthesis of antibiotics
abv01230  Biosynthesis of amino acids
Module
abv_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AGABI2DRAFT190399 (AGABI2DRAFT_190399)
   00330 Arginine and proline metabolism
    AGABI2DRAFT190399 (AGABI2DRAFT_190399)
Enzymes [BR:abv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AGABI2DRAFT190399 (AGABI2DRAFT_190399)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 18081450
NCBI-ProteinID: XP_006458015
JGI: Agabi_varbisH97_2_190399
Position
Unknown
AA seq 311 aa AA seqDB search
MPSLQFLPQPLTAAIVGCPFSGGQRRTGVDQGPIRLVEAGLVEQLKGLGWNVVFDGHHQF
EEYNNLDDAPIGIMKNPRTVSQVNRSVAGVVMNHAKNGMLPVTLGGDHSLAMGTISGSLA
VHPDACVIWIDAHADINTIETTDSGNMHGMPLSFLLGIGDKIQEFDWIKPVLKPERLVYI
GLRDLDAGEKRLLREHNIKAFSMHEVDKYGIGKVVEMALDYVNPKRDLPIHLSFDVDALD
PSVAPSTGTPVRGGLTFREGHYICEAIHETGLLVSLDLMEVNPSLAEAADADKTVAVGCS
LVRAALGETLL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcttacaattccttcctcagcctcttactgccgcaattgtcggctgcccattc
agtggcggacagcgcaggactggcgtggaccaagggccgatccgactcgtagaagcaggc
cttgttgaacaactcaagggcctcggatggaacgttgttttcgacgggcatcatcaattt
gaagaatacaataatctggatgatgcacccataggaataatgaagaaccctcgaacagtg
tctcaagtaaacagatctgtggctggggtggtgatgaatcatgcgaagaacggcatgctt
cctgtgacgctagggggtgatcattctttggcaatgggcaccatttctgggtcactcgcg
gtccatcccgatgcatgtgtcatttggatcgatgctcacgctgatatcaataccattgag
acgacggattcagggaatatgcatggcatgcctctatcttttctcctcggtattggcgac
aaaatacaagagtttgattggatcaagcccgttctgaagccagaacgcttagtctacatc
ggccttcgcgaccttgatgccggagaaaagcgattattgcgcgaacacaacattaaagcc
ttcagtatgcacgaagtcgataaatatggcatcgggaaagttgtcgaaatggcattggat
tatgtcaacccaaaacgagatctaccaatacatctcagctttgatgtagatgcactggat
cctagtgtcgccccatcaactggtactccggtgagaggtggacttaccttccgggagggt
cattacatctgcgaggccattcacgagactggtctactggtgtcattggatttaatggag
gtcaacccatctctcgcagaagctgcggatgccgacaagactgtcgctgtcggttgttcg
cttgtgagggctgctttgggggaaacacttttgtga

DBGET integrated database retrieval system