KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT192001Help
Entry
AGABI2DRAFT192001 CDS       T03140                                 

Gene name
AGABI2DRAFT_192001
Definition
(RefSeq) hypothetical protein
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00270  Cysteine and methionine metabolism
abv00450  Selenocompound metabolism
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
abv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AGABI2DRAFT192001 (AGABI2DRAFT_192001)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AGABI2DRAFT192001 (AGABI2DRAFT_192001)
Enzymes [BR:abv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     AGABI2DRAFT192001 (AGABI2DRAFT_192001)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1 SHOCT
Motif
Other DBs
NCBI-GeneID: 18081991
NCBI-ProteinID: XP_006460240
JGI: Agabi_varbisH97_2_192001
Position
Unknown
AA seq 765 aa AA seqDB search
MVLSSVLGFPRIGANREIKKAVEAYWAGKTSAEDLQKVAAEVRKTSWTSVKNHRVDFVPS
GEFSLYDHVLDHSAAFNVIPQRYVGLGLTPLDVYFAMGRGRQSEGVDVPASEMKKWFDSN
YHYVVPELSEETDLKLIYNKALEEFKEAKEAGITTRPVVLGPVSFLVLGKSAKSAQPGFR
PISLLPKLIPVYKQLLSELKAAGAEWVQIDEPILALDSAAALEKEYTASFTELAPVSPKI
MLTTYFSRLDSNVRFIAKLPVAGLHIDLDRAPDQLTEVANAVKNTPIVLSLGLVSGRNIW
KTDFGAAIKLAQTAIDILGAGRVIVATSSSLLHTPVTLASENKLTAEQKDWFSFALEKAE
EVAVIAAVLSGSQDASVTAALEANRVSINKRREFEKNSDDTVRKRVAAITPDQLNRKSPF
PVRKETQAKHLNLPKFPTTTIGSFPQTKEIRQARAKFNKGELTKEEYETFIKKEIEHVVR
FQESIDLDILVHGEPERNDMVQYFGELLNGFVFTQNAWVQSYGSRYVRPPIIVSDVSRPG
PMTVKWSSYAQSLTKKPMKGMLTGPVTILNWSFPRADISREMQSKQLALALRDEVIDLEN
AGIHAIQVDEPAIREGLPLRRADWDGYLEWAVDSFKLATAGVTDQLQTHSHFCYSDFDDI
FPSIQRLDADVISIEASKSDMKLLNTFKHYGYSNQIGPGVYDIHSPRVPGDQEIKDRLQA
MLSILPDSLVFVNPDCGLKTRGWKETEASLKNLVAGAKWARQNYA
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtcaagtgttctaggatttcctcgtatcggagctaaccgtgaaataaaaaag
gctgtcgaagcatactgggctggtaaaacctctgctgaagacctccaaaaagtggctgcg
gaggtgaggaagaccagctggacttcggtcaaaaatcatcgcgtcgactttgttcctagc
ggtgaattctctctctatgatcatgttcttgatcactctgccgctttcaatgtcattccc
cagcgttatgttggtctcggattgacccctcttgatgtttactttgctatgggtcgtgga
cgtcaatccgagggtgtcgacgtccccgcttccgagatgaagaaatggtttgactcaaac
taccattatgtcgttcccgagttgtcagaggagaccgatttaaagctcatctataacaag
gctcttgaggagttcaaagaagccaaggaggctggtatcaccactcgtcctgttgttctc
ggccctgtctctttccttgttctaggaaagagtgccaaatccgctcagcctgggttccga
cccatttccctcctgcctaaactcattcccgtctacaagcaacttctttcggagctgaaa
gccgcgggtgctgagtgggtccagattgatgaaccgatcttggcacttgatagcgctgcc
gccctcgagaaggagtatactgcttcattcactgagcttgcacctgtttctcctaagatc
atgctcaccacttacttttcccgcctcgattccaacgtgaggttcatcgccaagctaccc
gtcgctggtcttcacatcgatctcgatcgcgcccctgatcaactcactgaggtcgccaat
gcagttaagaacactcctattgtactttcgttgggcctcgtttccggccgcaacatatgg
aaaaccgatttcggcgctgctatcaagctcgctcaaactgctattgacatccttggtgct
ggtcgtgtcattgttgccacctcgtcttccctcctacacactcctgttactcttgcctct
gagaataagctgactgcagagcagaaggattggttctccttcgccctcgagaaagctgaa
gaagtcgctgttatcgccgccgttctttccggctctcaagatgcctcggtcacagccgct
ctagaggctaacagagtttctatcaacaagcgtcgtgagtttgagaagaactccgatgac
actgttcgcaagcgcgttgcggccatcacccctgatcaactgaatcgcaagagccccttc
ccggttcgaaaagaaacccaggccaagcatcttaatctccccaagttccccactaccact
atcggttccttccctcaaacaaaggaaattcgtcaagcccgtgccaagtttaacaagggt
gagctcaccaaagaggagtatgaaacgttcatcaaaaaagaaatcgagcatgtcgtgcgc
ttccaagagagtattgacctggatattcttgtccacggagagcctgaacgaaacgacatg
gttcaatacttcggtgaactccttaacggtttcgtcttcactcagaacgcctgggtgcag
agctacggttctcgctatgtgcgccctcccattatcgtttcagatgtcagtcgtcccggt
cccatgaccgttaagtggagtagctacgcccagagcctcaccaagaaacccatgaagggc
atgttaactggtcccgtcaccattctcaactggtcattccctcgggccgacatctcacgt
gaaatgcagtccaagcagctcgccctcgcactccgcgacgaggttatcgatcttgagaat
gctggaattcatgctattcaggtcgacgagcccgctatccgtgaaggtcttcccctccgc
cgggctgactgggatggctatcttgagtgggctgtagactctttcaagcttgcaacagct
ggtgtcactgatcaacttcagactcactctcacttttgctactctgactttgacgatatt
ttcccgtctattcaacgccttgacgctgatgttatttcgatcgaggcttccaagagtgac
atgaaactgctcaatacctttaagcactatggctattccaaccagattggtccgggtgtc
tatgatatccattcaccccgtgttcccggtgatcaggagattaaagaccgccttcaggcc
atgcttagcattctgccagactctcttgtctttgttaaccctgactgcggtctcaagacg
cgcggctggaaagagacggaagcttctctgaagaaccttgttgcaggcgccaagtgggct
cgtcaaaactacgcttga

DBGET integrated database retrieval system