KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT192415Help
Entry
AGABI2DRAFT192415 CDS       T03140                                 

Gene name
AGABI2DRAFT_192415
Definition
(RefSeq) hypothetical protein
  KO
K00958  sulfate adenylyltransferase [EC:2.7.7.4]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00230  Purine metabolism
abv00261  Monobactam biosynthesis
abv00450  Selenocompound metabolism
abv00920  Sulfur metabolism
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
abv01130  Biosynthesis of antibiotics
Module
abv_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AGABI2DRAFT192415 (AGABI2DRAFT_192415)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AGABI2DRAFT192415 (AGABI2DRAFT_192415)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AGABI2DRAFT192415 (AGABI2DRAFT_192415)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    AGABI2DRAFT192415 (AGABI2DRAFT_192415)
Enzymes [BR:abv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     AGABI2DRAFT192415 (AGABI2DRAFT_192415)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-sulfurylase PUA_2 APS_kinase
Motif
Other DBs
NCBI-GeneID: 18082143
NCBI-ProteinID: XP_006460822
JGI: Agabi_varbisH97_2_192415
Position
Unknown
AA seq 575 aa AA seqDB search
MANSPHGGVLKDLIARDVRIANELEEETQSLPNIILTERQLCDLELIMNGGFSPLEGFMN
EANYTSVVDNLRLVNGTLFSMPITLDVSKADIESIGIMPGSRITLRDPRDDEALAIITVD
DVYKPDQVREAIRVFGADDPAHPSVAYLRKNVKEFYVGGKVQAIRAPIHFDYVALRYTPA
ELRAHFTKLAWRRVVAFQTRNPMHRAHRELTVRAARQHRANVLIHPVVGLTKPGDVDHYT
RVRVYEAIMQKYPNGMGHLALLPLAMRMAGPREAVWHAIIRKNFGATHFIVGRDHAGPGK
NSLGKDFYGPYDAQDLVMKYRDELQIEMVPFQQMTYLPSTDEYQPVDEVPKGVQTLDISG
TELRRRLRTGAPIPDWFSYDAVVKVLRESYPPRHKQGFVLFFTGLHNSGKDQIAKALQVS
LYEQGGRSVSLLLGETVRQELSAELGYSREDRHKNLQRIAFVAAELTRAGAAVIAAPIAP
HEASREAARETILQNGGAGANVFLIHVATPLEYCERTDRKGLFAKARRGEIVGFSGVDDL
YEVPSKADITVDVSRQGVPEIVHSILLLLEAQSLL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggccaattctcctcatggtggcgtcctcaaggacctaattgctcgtgacgttcgcatt
gctaatgagctggaagaagaaacccagtcgcttccgaatatcattctcactgaacgtcaa
ctatgtgatcttgaactgatcatgaacggtggctttagccctctggagggtttcatgaac
gaggctaactacaccagtgtcgtggataatttgcgcctcgtcaatggaacgcttttttcc
atgccaattaccctcgacgtctcgaaagcagacatcgagagcataggtatcatgcctgga
tctcgaataacattgcgagacccgcgtgatgacgaggccctggctataattaccgtggac
gatgtctacaaacctgaccaggtcagagaggccatccgggtcttcggtgcggatgacccc
gcacatccatccgtagcctaccttcgtaagaacgtgaaggagttctatgttgggggtaag
gtgcaagccatccgtgcacctatacattttgattacgtcgctctccgatatacgcctgct
gagcttcgtgctcattttacaaaacttgcgtggcgccgtgttgttgccttccagaccaga
aaccctatgcaccgtgctcaccgcgaactaacggttcgcgctgctcgccaacaccgagct
aatgttctcatccatcccgtcgttggactcaccaagcccggcgatgtggatcattatacc
cgtgttcgtgtatacgaagctattatgcaaaagtaccctaacggaatgggacacctcgct
cttcttcccctggccatgcggatggccggtcctcgcgaggccgtttggcatgctattatc
cgcaaaaacttcggagcaacacatttcattgtgggcagagaccacgcaggtcccggaaaa
aattctcttggaaaggatttctatggtccttatgatgcccaggatttggttatgaagtac
cgagatgaattacaaatcgaaatggttcccttccagcaaatgacatatctaccttcaacg
gacgaataccaacctgttgatgaggttcccaagggcgttcaaacccttgatatttctggg
actgaacttcgaagacgattgcgtacaggtgctcctatccctgattggttcagttacgac
gctgttgtgaaagttctccgtgaaagctatcctcctagacacaagcaaggctttgtactt
ttcttcaccggccttcataactcgggaaaggaccaaattgccaaagcattgcaggtatct
ctctatgaacaaggtggacgcagcgtttcgcttctcctaggagagaccgttcgtcaagaa
ctttcagcagaacttggttactctcgcgaagaccgccacaaaaacctgcaacgcatcgct
ttcgttgctgcagagttaacgagagctggtgcagctgttattgctgctcccattgcccca
cacgaagcttctcgtgaggcggctcgtgaaaccatcctacaaaatggtggcgccggcgct
aacgtgttcctcatccatgttgcgacccctctagagtactgcgagaggacggacagaaag
ggtctctttgccaaggctcgtcgtggtgagattgttggcttcagcggcgttgatgatttg
tatgaggtgcccagcaaagccgatattactgtagatgtgtccaggcaaggcgtccctgaa
attgttcacagcatacttttgcttctagaagcacagtcactactttag

DBGET integrated database retrieval system