KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT210873Help
Entry
AGABI2DRAFT210873 CDS       T03140                                 

Gene name
AGABI2DRAFT_210873
Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00450  Selenocompound metabolism
abv00970  Aminoacyl-tRNA biosynthesis
abv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AGABI2DRAFT210873 (AGABI2DRAFT_210873)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AGABI2DRAFT210873 (AGABI2DRAFT_210873)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abv01007]
    AGABI2DRAFT210873 (AGABI2DRAFT_210873)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abv03016]
    AGABI2DRAFT210873 (AGABI2DRAFT_210873)
Enzymes [BR:abv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AGABI2DRAFT210873 (AGABI2DRAFT_210873)
Amino acid related enzymes [BR:abv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AGABI2DRAFT210873 (AGABI2DRAFT_210873)
Transfer RNA biogenesis [BR:abv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AGABI2DRAFT210873 (AGABI2DRAFT_210873)
 Prokaryotic type
   Other AARSs
    AGABI2DRAFT210873 (AGABI2DRAFT_210873)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e DUF4315
Motif
Other DBs
NCBI-GeneID: 18084581
NCBI-ProteinID: XP_006456109
JGI: Agabi_varbisH97_2_210873
Position
Unknown
AA seq 581 aa AA seqDB search
MWAARRASQRCGSVFVRRLNVLSASNTKPFYVTTPIFYPNAEPHIGHLQTLLIGDIYARY
NRLARPWNPVHFLAGTDEHGLKIQQAAAAAGKEPGAFCEELSKRFQELAEAASIQSTSFV
RTSSPKHRKVVEHVWNELTAKGLIRKTTYAGWYSVTDECFYTKKQVVHAPTPENPEARHA
IATNSAVEWHEEENYVFRLREFSEKLLEHYNEHPNSIYPAQYHLDVVQYLKAVIDGAQGE
GLDELSISRSIDRLSWGIPVPGDPSQTIYVWFDALLVYLSGVGYPDFEGAPKDLLPWPPN
MQIIGKDILRFHAIYLPSILLALDLPLPHHILAHAHWTVDQKKMSKSVGNVADPMKTIDD
YGVDKVRWYLARAGRSRTDVDWSQNELEKHSNEIQSLLGNYVLRVTSKKLFKSLDGTQEM
SIKQIYQHYKKQDDSKSKSLVDLIDTQRTTPARVKHGIENLEIAEAVRALVLLLREGNKT
LTELAPWKKNTPPELLYANYVTGLETLRIAGICLQPFIPSTAEKLLDMLGLERERGRTWR
AVERVGGTDACERVKKDIMDIHGVPLFQSKKPLPATVAKPV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtgggctgctcgacgtgcttcccaacgctgcggttcagtctttgtgcgtcgtctcaac
gtgttaagcgcgtcaaacacgaaaccattctatgttaccacacccatcttctacccaaat
gctgaaccacacatcggacatttacaaaccctgctcattggcgacatatatgctcgttat
aatcgcttagcccgtccctggaacccggtccacttcctcgctggtacagacgaacatggg
cttaagatacaacaggctgctgctgctgctggaaaggagcccggtgctttttgtgaagaa
ctaagcaaacggttccaagaactagcagaagccgcaagcattcaatcaacttcgttcgtt
cgtacatcctcacccaaacatcgcaaagtcgtcgaacatgtctggaatgagctcacggcg
aaaggcctcatccgcaaaacaacctatgctggttggtattccgttaccgacgaatgtttc
tatacaaaaaagcaagtcgttcatgcccccactccggaaaacccagaagcccgtcacgct
attgccactaattctgccgtcgaatggcacgaagaagagaattacgttttccgtctgaga
gaatttagtgagaagctgctggaacattacaacgaacatccaaactcgatatatcctgca
caataccaccttgacgtcgtacagtacctcaaagcagtcattgatggtgcacaaggagag
ggtctggacgagcttagcatctccaggtcgattgatcgattgagttggggtattccggtc
ccgggagacccttcccaaaccatttatgtctggtttgacgcacttttggtctatctctcc
ggggtagggtaccctgattttgaaggagctccgaaagacctgctgccctggccacctaac
atgcagatcatcggaaaggatattctacgattccatgctatctatttgccatccatatta
cttgcacttgatcttccccttccccatcacattcttgcgcatgcgcactggacagtcgac
cagaagaagatgtccaaaagcgtcggaaatgtggcggatcccatgaaaaccattgacgac
tacggagtcgataaagtgaggtggtatcttgctcgcgcgggtcgttcgcgtacggatgtt
gattggtcgcaaaacgagcttgagaaacacagcaacgagatccagtcattgcttggcaat
tatgttctccgtgtaacgtctaaaaaacttttcaaatcccttgatggaactcaggaaatg
tcaatcaagcaaatttatcagcattacaagaagcaagatgattctaagagcaaatcgttg
gtcgatcttatagacacacaacgcactactccagccagggtgaagcacgggatagaaaat
ttggagattgctgaagcagtgcgagctttggttttactattgcgtgaagggaataaaacc
ctcacagaactcgcaccttggaaaaaaaatactcccccagagttgctctacgcaaactat
gtcactggtcttgagacattacgtatagcgggtatctgtctccagccctttataccaagc
acagcagagaagctattggatatgctgggattggaaagggaaagaggaagaacgtggaga
gctgtagaaagggttggtggaacagatgcatgtgagagggtcaagaaggatatcatggat
atccatggtgtacctctgttccaatctaagaaaccgcttcctgccactgtcgctaagccg
gtttga

DBGET integrated database retrieval system