KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT219039Help
Entry
AGABI2DRAFT219039 CDS       T03140                                 

Gene name
AGABI2DRAFT_219039
Definition
(RefSeq) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00564  Glycerophospholipid metabolism
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
Module
abv_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AGABI2DRAFT219039 (AGABI2DRAFT_219039)
Enzymes [BR:abv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AGABI2DRAFT219039 (AGABI2DRAFT_219039)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase C2 DUF2315
Motif
Other DBs
NCBI-GeneID: 18085002
NCBI-ProteinID: XP_006459702
JGI: Agabi_varbisH97_2_219039
Position
Unknown
AA seq 755 aa AA seqDB search
MLEIQGAEDLPRLRNMTRTGWDMDPFVVISFGKKVFRTRVIRHSRNPSWDEKLLFHVRRY
EASFNVQLAILDWDKLSANDHIGDVSFNVKELLECAPQPGENGLYADEAEDGDHPMKEFK
MPLVVAKEVPGESKHTPMISFRAKYQPYDALRQRFWRQYMKQYDADGTGALSHVEITTML
DSLGSTLSSSSISTFFTRYGKRAHEDELSFNETILCLEEELNRPEDQKRRLDEDNGDSSV
DATPVLQFADGTGKVLQLDQLDFSGPANLHGASEAPGETRTEPMQVPLHQAASSPTPPEF
SSSDDAEEDLSVGSPSTLSPAIGSPTTPQAKKGGAFKGVRVRVGRRKRRSQISSSNVSAS
EDSSNKEDTVERVINIKNCPLCHRPRMNSKAEMDIMTHIAVCASQDWNRVDHIMVGNFVT
ASQAQRKWYTKVISKLSSGDYKLGANSANIIVQNRMTGQLEEEKMQVYVRLGIRLLYKGV
KGRMEGNRARKLLKSLSIKQGIKYDSPESAEDIPAFIEFHKLNMDEILDPLESFKNFNQF
FYRKLKPSARPIEALDDPYRLVSAADCRLMAFETVHEATKIWVKGREFSVPRLLGDVYKD
EVDKYVGGALAIFRLAPQDYHRFHSPVDGVIGKMTYISGEYYTVNPQAIRTALDVYGDNV
RKIVPIDSPQFGRVMAVCVGAMMVGSILTTVEEGQEVKRGQEFGYFAFGGSTIVLLFEKG
AVTWDEDLLVNGRASLETLVRVGMGIGVGARRPTS
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagatccaaggcgcggaagacttgcctagactacgtaacatgacacgtaccggt
tgggatatggatccttttgtcgttatctcctttgggaaaaaagtctttcgcactcgcgtc
attcgtcactcccgtaacccctcctgggacgagaaactcttgtttcacgtccgtcggtac
gaagcctccttcaacgtccaattggccattttggactgggataaactctccgccaacgat
cacataggtgatgtcagtttcaacgtcaaggaattgttggaatgtgcgccacagcccgga
gagaatgggttgtatgcggacgaggccgaggacggtgatcaccccatgaaagagttcaag
atgcctttggtcgttgccaaggaagttccgggagagtctaaacatactcccatgatttcg
ttccgtgcgaaatatcaaccttacgatgcccttcgccagcgcttctggcgtcaatacatg
aaacagtacgatgccgatggtacaggcgcactctctcacgtcgaaataacgaccatgctc
gactctcttggatctaccctgtcctcctcatctatatccaccttctttacgcgttacggt
aaaagggcacacgaagatgaactgtctttcaatgaaaccatcctttgtttagaagaagaa
ttgaatcgacctgaagatcagaaacgacgattggacgaggataacggtgactcgagtgta
gatgcgacgccggtattgcaatttgcagatgggactggaaaagtgttgcagctcgatcaa
cttgatttctctggccctgcaaatcttcatggcgcttcggaagctcctggtgagaccaga
acggagcccatgcaagtgcctcttcatcaagctgcttcctcgcctacgccacccgaattc
agttcttcggatgatgcagaggaagacctgtctgtaggatcgccttccaccttgagtcct
gctatcggtagtccaaccactcctcaagcaaagaaaggtggagcgttcaagggagtccgt
gttcgtgtaggccgccgaaaacgcagaagccagatatcctcttcaaacgtctctgcctcg
gaagacagcagtaacaaagaagatacggtcgaacgtgttatcaatatcaagaattgtcca
ctctgtcatcgacctcgcatgaattcgaaagcagagatggatattatgactcatattgct
gtttgtgcttctcaagattggaatagggtggatcatattatggttgggaattttgtgacg
gcgagtcaggctcagaggaagtggtatacgaaagtgatttcaaagttgagtagtggagat
tacaagttgggtgctaactcggcgaatattattgttcaaaatcggatgacggggcagttg
gaggaagagaagatgcaagtgtatgtcaggttgggaattcggttgttgtacaagggtgtg
aaagggcgtatggaaggtaatcgagctcgtaaacttctcaagtctctctccattaaacaa
ggtatcaagtatgattctccggaatctgctgaagacatacctgcatttatcgaatttcac
aaattgaatatggatgaaatccttgatccccttgagtcattcaaaaactttaatcaattc
ttttatcgcaagctcaaaccttctgctcgccccatcgaagccctcgatgatccttaccgt
ctcgtcagtgctgccgactgtcgtcttatggctttcgaaaccgtgcatgaggctacgaag
atctgggtcaaagggcgagagttttcggttccgagacttttgggggatgtgtataaagat
gaggtggataagtatgttgggggggcgttggcgatatttaggttggctccacaggattat
catcgatttcattcacctgtggatggtgttattggaaagatgacgtatatttctggagag
tattatactgtcaacccacaagcgattcggacggcgttggatgtttatggagataatgta
cgcaagattgtgcctattgatagtccgcagtttggacgcgtgatggctgtttgtgtgggt
gcgatgatggtggggagtattttgacgactgtggaggaaggacaggaagtgaaacgtggt
caggaatttggatattttgcatttggtgggtcgacgattgtgttgttgtttgagaagggt
gctgtgacttgggatgaggatctgttggttaatgggagagcgtctttggagactttggta
agagttgggatggggattggagttggtgctcgacgtcctaccagttaa

DBGET integrated database retrieval system