KEGG   Acinetobacter baumannii AC29: BL01_01020Help
Entry
BL01_01020        CDS       T03377                                 

Gene name
argS
Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:abw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BL01_01020 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abw01007]
    BL01_01020 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abw03016]
    BL01_01020 (argS)
   03029 Mitochondrial biogenesis [BR:abw03029]
    BL01_01020 (argS)
Enzymes [BR:abw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BL01_01020 (argS)
Amino acid related enzymes [BR:abw01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BL01_01020 (argS)
Transfer RNA biogenesis [BR:abw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BL01_01020 (argS)
 Prokaryotic type
   Other AARSs
    BL01_01020 (argS)
Mitochondrial biogenesis [BR:abw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BL01_01020 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1f tRNA-synt_1g Rep_3 T7SS_ESX1_EccB
Motif
Other DBs
NCBI-ProteinID: AIA50427
UniProt: V5VI16
Position
206538..208328
Genome map
AA seq 596 aa AA seqDB search
MNTAIQAALDHAVQTLQQEGVLPSDWNNSSNLTRTKDRSHGDFASNIAMIGSKAAGMKPR
DLAEKILAALPEVADISKAEIAGPGFINFFLNADQRFAILDQIQAQKESFGRSQSNAAKK
IQVEFVSANPTSSLHVGHGRGAAYGMTVANLLEATGAKVDREYYVNDAGRQMDILATSTY
LRYLELLGQNLVFPKNAYQGDYVKEIAQGIIDKDGDAYVREVANVYKDVPEDVQYAEELD
SEGNKVVLSGDKEKHIDGLIANSQQLLGEGYRVFHQAALHAILDDIKDDLADFGVTFNQW
FSEASLSAKIDEALETLDQRGFLYEKDGNIWFKSTEFGDEKDRVVKRRNGQTTYFASDIA
YHLNKLQRGYTDLVDIWGSDHHGYISRVKAAIDAMGYDSKKLTVLLVQFVSLWRGGEMVQ
MSSRSGQFVTLRDLRKEVGNDAARFYYVMRKSEQHIDFDLDLAVSQSKDNAVYYIQYAHA
RICRMLEKAASTGLQFEVSAARSHAARLSLDAETEILAKLAAYPDVVLRAANAYEPHQVG
NYLKELAALFHGWYNEHKVLSDDAELTQARLLLSINVQQVLRNGLELLGVSAPEAM
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggcaatacaagcagctctcgaccatgcagtgcaaacccttcagcaagaaggt
gtgcttccttcggattggaataattcaagcaatttaacacgcaccaaagaccgaagccat
ggcgattttgcttctaatattgccatgatcggctctaaagctgctggtatgaaaccacgc
gatttagctgagaaaattctagcagcgctaccagaagttgcagacatcagcaaagctgaa
attgcaggccctggttttatcaatttctttttaaatgcagatcaacgttttgcaattctt
gaccagattcaagctcaaaaagaaagctttggtcgtagccaatcaaatgcagctaaaaag
attcaagttgaatttgtttctgcaaacccgacgtctagcctacacgtaggtcatggccgt
ggtgctgcttatggtatgactgttgcaaacttgcttgaagcaacaggtgctaaagttgac
cgtgagtactacgtgaatgatgctggccgtcaaatggatattttggcgacttctacttat
ttacgttatttggaattacttggacaaaaccttgtattccctaaaaatgcatatcaaggc
gattacgttaaagaaatcgcacaaggcatcattgataaagatggcgatgcttacgttcgt
gaagttgcgaatgtttataaagatgtaccagaagacgtgcaatatgctgaagagctagat
agcgaaggcaacaaagtcgtattatctggtgataaagaaaaacacattgacggtcttatt
gccaactcacaacaattattaggtgaaggctaccgcgtattccatcaagcagcacttcat
gccattttagatgatattaaagatgatcttgctgacttcggcgtaacctttaaccaatgg
tttagtgaagcatctcttagcgcaaaaattgacgaagcgttagaaacacttgatcaacgc
ggcttcttatatgaaaaagatggcaacatctggtttaaatcgactgaatttggtgatgaa
aaagaccgtgttgtgaagcgccgtaatggtcaaacgacttactttgcatctgacattgca
tatcacttaaataaactacaacgtggttatactgaccttgttgatatttggggttctgac
caccacggttatatctctcgcgtaaaagctgcgattgatgcaatgggttatgactcgaaa
aaattaactgttcttttagttcagttcgtaagcttatggcgtggtggtgagatggttcaa
atgtcatctcgttcaggtcagttcgtgactttacgtgacttgcgtaaagaagtcggcaat
gatgcagctcgtttctactacgtgatgcgtaaaagtgaacaacacattgactttgacctt
gaccttgctgtttcacaaagtaaagacaatgcggtgtattatattcaatacgctcatgca
cgtatttgccgtatgctagaaaaagcagcaagcactggcttacaatttgaagtaagtgct
gctcgttcacatgctgcacgtttatcacttgatgcagaaactgaaattcttgctaaactg
gctgcatatccagacgttgtgttacgtgctgctaatgcatatgaaccacaccaagtaggt
aactacttaaaagaattagctgcgctattccacggttggtacaatgaacacaaagtttta
agtgatgatgctgaacttacacaagcacgcttattactttcaatcaatgtacagcaagta
ttgcgcaatggcttagaattactcggtgtttctgcacctgaagccatgtaa

DBGET integrated database retrieval system