KEGG   Acinetobacter baumannii AC29: BL01_01325Help
Entry
BL01_01325        CDS       T03377                                 

Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw00640  Propanoate metabolism
abw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BL01_01325
Enzymes [BR:abw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     BL01_01325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AIA50484
UniProt: A0A0D7U6A7
Position
complement(271081..273687)
Genome map
AA seq 868 aa AA seqDB search
MNTKYRKPLAGTQLEYYDVRQAVEDIQPGAYEKLPYTSKVLAEQLVRRADAENLTAYLTQ
LIERRQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGDPSKVNPVVPTQLIVDH
SLAVEYGGADPDAFAKNRAVEDRRNEDRFHFIEWTKTAFKNVDVIPAGNGIMHQINLEKM
SPVIQARDGVAFPDTCVGTDSHTPHTDALGVISVGVGGLEAENVMLGRASWMRLPDIIGV
ELVGQRQAGITATDIVLALTEFLRKERVVGAYLEFFGEGADSMSVGDRATISNMTPEYGA
TAAMFYIDQNTIDYLRLTGREDAQVALVEQYAKEIGLWASEMTKAEYPRVLRFDLSTVTR
NIAGPSNPHARVSTSDLKEKGIAGVVENRSDGLMPDGAIIIAAITSCTNTSNPRNTVAAG
LLARKANELGLTRKPWVKTSFAPGSKAAALYLEEAGVLKDLEQLGFGIVAYACTTCNGMS
GALDPVIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDI
EKDALGHDKEGNPIYLKDIWPSDAEIDALVKEAVKPEQFRKVYIPMFDLGEVEQAKSPLY
DWRPQSTYIRRPPYWEGALAAPRTLANMRPLAILGDNITTDHLSPSNAILMDSAAGEYLH
KMGVPEEDFNSYATHRGDHLTAQRATFANPKLYNEMVRRSDGTIKQGSKARVEPEGEVMR
MWEAIETYMNRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGM
GVLPLEFKPGVNRKTLKLDGTELYSVIGNIAPRSTLTLVIERATADGKEEILEVPVTCRL
DTEEEVSVYEAGGVLQRFAQDFLEGQVA
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaataccgtaaaccgctggcaggtacccagcttgaatactacgacgtgcgt
caagccgttgaagatattcagccaggcgcatacgaaaaactgccttacacctctaaagta
ctcgcagagcaattggtacgccgtgccgatgccgagaacttaactgcttatttaacgcag
ttgattgaacgccgtcaggacttggactttccttggtatccagcgcgcgtggtgtgtcat
gacatcttgggtcaaactgcattggttgaccttgcaggtttgcgtgatgcgattgctgag
aagggcggcgacccatctaaagttaacccagttgtaccaacacagctcattgtcgaccac
tctttagcagtggaatacggtggtgctgacccagacgcttttgcaaaaaaccgtgctgtt
gaagaccgtcgtaacgaagaccgtttccactttattgagtggaccaaaactgcatttaaa
aatgtcgatgtgatccctgcggggaacggcattatgcaccagattaacctagagaaaatg
tctccggtgattcaggcgcgtgatggcgtagcattcccagatacatgtgtcggtacagac
tcacacacaccacatacagacgccttgggcgtaatttctgtgggtgtaggtggtttagaa
gctgaaaacgtaatgttgggccgtgcatcttggatgcgtctgccagacattattggtgtt
gagttggttggtcagcgtcaggcaggcattactgcaacagatatcgtacttgctttaacc
gagttcttgcgtaaagagcgcgtagtgggtgcttaccttgagttctttggtgaaggcgct
gacagcatgtctgtgggtgatcgcgcaaccatttcgaacatgacaccagaatatggcgct
acggctgcgatgttctacattgaccaaaacacaatcgactacttacgcctaacaggccgt
gaagatgctcaagtggcattggttgaacagtacgcaaaagaaatcggcctttgggcatct
gaaatgaccaaagcagagtacccacgtgtactacgttttgatttatcgacagttacacgt
aacattgctggtccatcaaacccacatgcacgtgtttcaaccagcgacctaaaagaaaaa
ggcattgcaggtgtagttgaaaaccgttctgacggcttaatgccagatggcgcaatcatt
attgctgcaattacttcatgtaccaatacttctaacccacgtaacaccgtggcggcaggc
ttgttggcacgtaaagcaaatgaacttggcctaacacgtaaaccgtgggtgaaaacctca
tttgcaccgggttcaaaagcggctgcactttaccttgaagaagcaggtgtcctaaaagac
ttagaacaacttggttttggtattgtggcttacgcttgtacgacctgtaatggtatgtct
ggtgcgttagatccagtcatccaacaagaaattattgaccgtgacttgtacgcaacagca
gtactttctggtaaccgtaacttcgatggccgtatccatccatatgcaaaacaagcattc
ttggcgtctccaccgcttgttgtggcatatgcaattgcgggtacgattcgttttgacatc
gaaaaagatgcgttaggtcatgacaaagaaggtaacccgatttacctcaaagacatttgg
ccatctgatgctgaaattgatgccttagttaaagaagccgtgaagcctgaacagttccgt
aaagtttacattccgatgtttgacttgggcgaagtcgaacaagcgaagagcccactttac
gactggcgtccgcaaagtacttacatccgccgtccaccatattgggaaggggcgttggct
gcaccacgtactttagcaaacatgcgtccacttgcgattttgggtgataacatcaccacc
gatcacttgtcgccttcaaacgcgattttgatggactcggctgcgggtgaataccttcac
aaaatgggcgtaccagaagaagacttcaactcatatgcaacgcaccgtggtgaccacttg
actgcacaacgtgcaacatttgccaacccgaaactctataacgaaatggttcgccgttca
gacggtaccattaagcaaggttcaaaagcgcgtgtagagccagaaggcgaagtgatgcgt
atgtgggaagcaattgaaacctacatgaaccgtaagcagccgttaattattatcgcgggt
gctgactacggtcagggttcaagccgtgactgggctgcaaaaggtgtacgccttgcaggt
gtagaagcgattgtggcagaaggttttgagcgtattcaccgtactaacttggtgggtatg
ggcgtgttaccgcttgagtttaaaccgggtgtaaaccgcaagactttaaaactagatggt
acagagctttatagcgtgattggtaatattgcgccgcgttcgactttaactttagtgatt
gaacgtgccacagcggatggtaaagaagagattcttgaagtgcctgtgacttgccgttta
gatacagaagaagaagtttctgtatatgaagcgggcggtgtattacagcgttttgcgcaa
gactttttagaaggccaagtggcttaa

DBGET integrated database retrieval system