KEGG   Acinetobacter baumannii AC29: BL01_03910Help
Entry
BL01_03910        CDS       T03377                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw00740  Riboflavin metabolism
abw00790  Folate biosynthesis
abw01100  Metabolic pathways
abw01110  Biosynthesis of secondary metabolites
abw02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:abw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BL01_03910
   00790 Folate biosynthesis
    BL01_03910
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BL01_03910
Enzymes [BR:abw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BL01_03910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AIA50967
UniProt: V5V9J6
Position
806515..807117
Genome map
AA seq 200 aa AA seqDB search
MPIEFIATSKLPTAFGEFNISVFQDPVTGEEHVALSKGLENPPTGPVLVRVHSECLTGDA
FASLKCDCGPQLQATQKLINEAGQGVILYLRQEGRGIGLTNKIRAYALQDQGHDTVDANL
LLNLPADARRYDMCSIMLDHLKVKEVKLITNNPLKIQALKDQGINVVDRVPLTVGRNPFN
EQYLKTKRERMDHLYQKDDF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgcctatagagttcattgcaacatcaaaactcccgaccgcttttggtgaattcaatatt
tctgtgtttcaagatcccgtaacaggtgaagaacatgtggcactttccaaagggttagaa
aatccgccaacgggtcctgttttggtccgcgtacattctgaatgcttaacgggtgatgca
tttgcatcattgaaatgtgactgtggcccacaactacaagccactcagaaactcatcaat
gaagcaggacaaggtgtaattttatacttacgccaagaaggacgcggtattggtttaacc
aataaaattcgtgcttatgccctgcaagatcaggggcacgatacagtagatgccaattta
ctactgaatttacccgccgatgcacgtcgttacgatatgtgcagcattatgctcgaccac
ttaaaagtgaaagaagttaaattaattaccaataatcctttgaaaattcaggcactcaaa
gatcaaggtattaatgtcgtagaccgtgtacctttaactgtcggccgtaacccttttaat
gaacaatatttaaaaaccaaacgtgaaagaatggatcacctttaccaaaaagatgatttt
tga

DBGET integrated database retrieval system