KEGG   Acinetobacter baumannii AC29: BL01_10530Help
Entry
BL01_10530        CDS       T03377                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw00071  Fatty acid degradation
abw00072  Synthesis and degradation of ketone bodies
abw00280  Valine, leucine and isoleucine degradation
abw00310  Lysine degradation
abw00362  Benzoate degradation
abw00380  Tryptophan metabolism
abw00620  Pyruvate metabolism
abw00630  Glyoxylate and dicarboxylate metabolism
abw00640  Propanoate metabolism
abw00650  Butanoate metabolism
abw00900  Terpenoid backbone biosynthesis
abw01100  Metabolic pathways
abw01110  Biosynthesis of secondary metabolites
abw01120  Microbial metabolism in diverse environments
abw01130  Biosynthesis of antibiotics
abw01200  Carbon metabolism
abw01212  Fatty acid metabolism
abw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BL01_10530
   00630 Glyoxylate and dicarboxylate metabolism
    BL01_10530
   00640 Propanoate metabolism
    BL01_10530
   00650 Butanoate metabolism
    BL01_10530
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BL01_10530
   00072 Synthesis and degradation of ketone bodies
    BL01_10530
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BL01_10530
   00310 Lysine degradation
    BL01_10530
   00380 Tryptophan metabolism
    BL01_10530
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BL01_10530
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BL01_10530
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BL01_10530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abw04147]
    BL01_10530
Enzymes [BR:abw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BL01_10530
Exosome [BR:abw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BL01_10530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Tex_N
Motif
Other DBs
NCBI-ProteinID: AIA52230
UniProt: V5V9J5
Position
2206862..2208037
Genome map
AA seq 391 aa AA seqDB search
MTDIVIVNGARTAMGGFQGSLSGLTAPELGAVTIKEAIARAGLQPTDVEEVIMGCVLPAG
LKQGPARQAMRKAGLPDSTGAVTINKLCGSGMKAVMQAADMIKAGSAEIVVAGGMESMTN
APYVLPKARAGYRMGHGEIKDHMFFDGLEDAETGRLMGSFAQDMANTRGYTREQMDDFAI
RSLKRAQTAITEGYFKDEIVPVTVSTRKGDVIVDQDEQPLNAKIDKIPSLKPAFAKDGTI
TAANASSISDGASALVLTSSEVAAQRGLQPLAKIIATASNSQHPSEFTIAPVGAIEKVLK
KAGWNAQDVDLWEINEAFAMVTMCPIDDFKLDPEKVNIHGGACALGHPVGSTGSRIILTL
IHALKRTGGKKGVAALCIGGGEATAVAIEIL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatcgtaattgttaatggtgctcgtactgctatgggtggttttcaaggatca
ctatcaggactaactgctcctgaattaggagcagtaacaattaaagaagcaatcgcacga
gcaggtttacagcctacagatgtcgaagaagtcattatgggttgcgtactaccagcgggt
ttaaagcaaggccctgctcgtcaagccatgcgtaaagcaggtttacctgattcaacagga
gctgtgacaattaataagctttgtggttcaggtatgaaggcggtaatgcaagcggctgat
atgattaaagcaggaagtgctgaaattgtagttgccggtggtatggagtcgatgaccaat
gcgccttatgtcttacccaaagcacgtgcgggataccgtatgggccacggtgaaattaaa
gaccatatgttctttgatggcttagaagatgctgaaactggacgtttaatgggttcattt
gctcaagatatggcaaatacacgtggttatactcgtgagcaaatggatgactttgcaatt
cgttctttaaaacgtgctcaaactgcgattactgaaggctatttcaaagatgaaattgta
cctgttactgtttctacccgtaaaggtgatgtcattgtcgatcaggatgaacaaccctta
aatgccaagattgataaaatcccatcccttaaaccagcttttgcaaaagacggtaccatt
actgctgcaaacgcgagttcaatttctgatggtgcttctgcactagttttaacatcgagt
gaagttgcagcacagcgcggcttacaaccacttgcaaaaatcatagccactgcgtcaaat
tctcaacatccttcagaatttacaattgctcctgttggcgctattgaaaaagtacttaaa
aaagcaggttggaatgctcaggacgttgacctttgggaaattaatgaagcttttgctatg
gtaacgatgtgtccaattgatgatttcaaacttgatccagaaaaagtcaatattcatggt
ggagcatgtgcacttggtcatcctgtaggatcgacaggctctcgtattattcttacgctt
attcatgcgcttaaacgtactggtggtaaaaagggtgtcgctgctctttgcatcggcggt
ggggaagcaacagctgttgccatcgaaattctttaa

DBGET integrated database retrieval system