KEGG   Acinetobacter baumannii AC29: BL01_10575Help
Entry
BL01_10575        CDS       T03377                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw00071  Fatty acid degradation
abw00072  Synthesis and degradation of ketone bodies
abw00280  Valine, leucine and isoleucine degradation
abw00310  Lysine degradation
abw00362  Benzoate degradation
abw00380  Tryptophan metabolism
abw00620  Pyruvate metabolism
abw00630  Glyoxylate and dicarboxylate metabolism
abw00640  Propanoate metabolism
abw00650  Butanoate metabolism
abw00900  Terpenoid backbone biosynthesis
abw01100  Metabolic pathways
abw01110  Biosynthesis of secondary metabolites
abw01120  Microbial metabolism in diverse environments
abw01130  Biosynthesis of antibiotics
abw01200  Carbon metabolism
abw01212  Fatty acid metabolism
abw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BL01_10575
   00630 Glyoxylate and dicarboxylate metabolism
    BL01_10575
   00640 Propanoate metabolism
    BL01_10575
   00650 Butanoate metabolism
    BL01_10575
  Lipid metabolism
   00071 Fatty acid degradation
    BL01_10575
   00072 Synthesis and degradation of ketone bodies
    BL01_10575
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BL01_10575
   00310 Lysine degradation
    BL01_10575
   00380 Tryptophan metabolism
    BL01_10575
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BL01_10575
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BL01_10575
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BL01_10575
Enzymes [BR:abw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BL01_10575
Exosome [BR:abw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BL01_10575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AIA52239
UniProt: A0A270NJY5
Position
2217852..2219057
Genome map
AA seq 401 aa AA seqDB search
MSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNELQQRHQLDTTKVDDIVLGCVTP
IGDQGGDIAKTAAIAAGWNDDVAGVQINRFCASGLEAVNMAAMKVRSGWEDLVVAGGVES
MSRIPMGSDGGPWALDPETNLKSSFVPQGVGADLIATLDGYSREDVDNFAVKSQQKAAAA
QANGYFDQSVVPVKDHAGIVILEKDEFIKGNTTLEGLAKLNPSFEMMGQMGFDAVALQKY
PEAQKVNHVHHAGNSSGIVDGAALVLLASEKAVKEQNLKPRAKVLATALVGTDPTIMLTG
PAPAARKALEKAGLTIDDIDLFEVNEAFAAVVMRFINELNVPAEKVNVNGGAIALGHPLG
ATGAMILGTLLDELERQNKKRGLATLCVGGGMGIATIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcttatattattgacgccattcgcacaccacgcggaaaaggaaaaaaagac
ggctctctttacgaagtaaaaccaatcacattactcaccactctattaaacgaattacag
caacgccatcaactcgatacaactaaagtagatgatattgttctgggctgcgtgacacca
attggtgatcagggcggtgatattgccaaaacagcagcgattgcagcgggctggaatgat
gatgttgcaggtgtgcaaattaaccgcttttgtgcttcaggtttagaagcggtcaacatg
gcagccatgaaagttcgttctggttgggaagatttagtggttgctggtggcgttgaatca
atgtcacgtatcccaatgggttctgatggcggaccgtgggcgttagatccggaaaccaac
cttaaatcatcttttgttccacaaggtgtcggcgctgacctcattgcaaccttagatggc
tatagccgagaagatgttgataattttgccgtaaagtcacaacaaaaagcagcggcagct
caagcaaatggttatttcgatcaatcagttgtgccagtcaaagatcacgcaggtattgtg
attttagaaaaagatgaatttattaaaggcaataccacacttgaagggttagcaaagctc
aacccaagttttgaaatgatgggacaaatgggctttgatgctgttgccctgcaaaaatat
ccagaagcacaaaaagtaaatcatgttcatcatgctggtaactcatcaggtattgtcgat
ggagcagctcttgttttactggcttcagaaaaagcagtgaaagaacaaaacttaaaacca
cgcgctaaagttttggcaactgccctagtcggtactgatccaaccattatgctgactggc
cctgcgcctgctgcacgcaaagccttggaaaaagctggtttaacaattgatgatattgac
ctatttgaagtcaacgaagcatttgcagctgtcgtaatgcgttttataaatgaactcaat
gtgcctgctgaaaaagtcaacgtaaatggcggtgcgattgctttaggtcatcccttaggg
gcaactggtgccatgattttgggtacattacttgatgagcttgaacgtcaaaataaaaaa
cgcggtttagcaacgctctgtgtcggcggtggtatgggtattgccaccattattgaacgt
gtataa

DBGET integrated database retrieval system