KEGG   Acinetobacter baumannii AC29: BL01_10785Help
Entry
BL01_10785        CDS       T03377                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:abw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BL01_10785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abw01007]
    BL01_10785
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abw03016]
    BL01_10785
   03029 Mitochondrial biogenesis [BR:abw03029]
    BL01_10785
Enzymes [BR:abw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     BL01_10785
Amino acid related enzymes [BR:abw01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BL01_10785
Transfer RNA biogenesis [BR:abw03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BL01_10785
 Prokaryotic Type
   Other AARSs
    BL01_10785
Mitochondrial biogenesis [BR:abw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BL01_10785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: AIA52280
UniProt: N0A5J2
Position
2264739..2266517
Genome map
AA seq 592 aa AA seqDB search
MMRTHYCGSLTEAQIDQTVTLCGWVHRRRDHGGVIFLDMRDRDGLVQVVIDPDTPEAFAT
ADKARSEYVLKITGRVRRRYEGTENPNMVSGQIEVLGKEIEVLAASETPPFPLNDDTINV
SEEHRLKYRFLDIRRPEMLERLRFRSKVTNLIRNYLDDHGFLDVETPILTRATPEGARDY
LVPSRVQNGSFYALPQSPQLFKQLLMVGGIDRYYQIAKCFRDEDLRADRQPEFTQIDIET
SFLNDDDIMDLMEGMTVKLFNDLLGVKFEKFRRMPYSEAMRDYASDKPDLRIPLKLVDVA
DLMQEVEFKVFAGPAKDPKGRIAALRVPGAGSLTRSQIDEYTKFVGIYGAKGLAYIKVNE
IEKGIEGLQSPIVKFIEPIVMQLLERVGAENGDIVFFGADKAKIVNDAMGALRVKIGHDL
NLATCEWAPLWVVDFPMFEETDDGKWTSVHHPFTLPKSSVEDVKSNPGEALSVAYDMVLN
GTEVGGGSLRIYTLEMQKAIFEALGISDEEAEEKFSFLLNALRYGAPPHGGLAFGLDRLV
MLMTGATSIRDVIAFPKTKTAECPLTQAPAPVEANQLRDLGIRLREQQKKEA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgaactcattactgtggctctttaactgaagcccaaatcgaccagaccgttaca
ttatgcggttgggtacatcgtcgccgtgaccatggcggtgttattttccttgatatgcgt
gaccgtgatggtctcgttcaagtggttattgacccagatactccagaagcatttgcaact
gcagataaagcacgttctgaatatgtattaaaaattacaggtcgtgttcgtcgccgttat
gaaggtactgaaaacccaaatatggtgagtggtcaaatcgaagttttaggcaaagaaatc
gaagttcttgctgcatctgaaactccaccattcccattaaatgatgacactattaacgtg
tcagaagaacaccgtttaaaatatcgtttcttggacatccgtcgtccagaaatgttagag
cgtttacgcttccgttctaaagtaaccaacttgattcgtaactatttagatgatcatggt
ttcttagacgttgaaactccaattttaactcgtgcaacccctgaaggtgcgcgtgactat
ttagtaccaagccgtgtacaaaatggtagcttctatgcccttccacaatccccacaatta
ttcaaacaattgttgatggttggtggtattgatcgctactaccaaatcgcgaaatgtttc
cgtgatgaagacttacgtgctgaccgtcagcctgaatttactcaaatcgacattgaaaca
tcgttcttaaacgatgatgacattatggatttgatggaaggtatgactgttaaattattt
aacgacttgcttggcgtaaaatttgaaaaattccgccgtatgccatacagcgaagcaatg
cgtgattatgcatctgacaaaccagacttgcgtattccgttaaaactcgttgatgttgca
gacttaatgcaagaagttgagttcaaagtatttgcaggtccagctaaagaccctaaaggc
cgtattgcagcacttcgtgtaccgggcgcaggttcattaacacgtagtcagattgacgaa
tacactaaatttgtcggtatctacggtgcaaaaggcttagcatacattaaagtcaatgaa
atcgaaaaaggaattgaaggccttcaatctcctatcgttaaattcatcgaaccaatcgta
atgcaattgcttgaacgtgttggcgctgaaaatggcgatatcgtattctttggtgcggac
aaagctaaaattgtaaatgatgcaatgggtgcgcttcgtgtcaagatcggtcatgacttg
aaccttgcgacttgtgagtgggctccactttgggttgttgacttcccaatgtttgaagaa
actgacgatggcaaatggacttctgttcaccatccattcacattacctaaatctagcgta
gaagacgtgaagagcaatccaggcgaagcactttctgttgcttacgacatggtattaaac
ggtactgaagttggtggtggttcacttcgtatttacacattagaaatgcaaaaagcgatt
tttgaagcgcttggtatttccgatgaagaagcagaagaaaaattcagcttcttactcaat
gcgcttcgttacggtgcacctcctcacggtggtttggcatttggtcttgaccgtttagta
atgcttatgactggcgcgacttcaattcgtgatgttattgcgttccctaaaacgaaaact
gctgaatgtccacttactcaagcaccggctcctgttgaagcaaaccagcttcgtgacttg
ggcatccgcttacgtgaacaacaaaagaaagaagcttaa

DBGET integrated database retrieval system