KEGG   Acinetobacter baumannii AC29: BL01_16315Help
Entry
BL01_16315        CDS       T03377                                 

Definition
(GenBank) calcium-binding protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw00053  Ascorbate and aldarate metabolism
abw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BL01_16315
Enzymes [BR:abw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     BL01_16315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40 Pectate_lyase22 Lactonase DUF5122
Motif
Other DBs
NCBI-ProteinID: AIA53325
UniProt: A0A1K1WV32
Position
complement(3292161..3293039)
Genome map
AA seq 292 aa AA seqDB search
MEIKVLVDVKTKLGECPTWDTVRQRLFWVDIVDGRLFCCDEFGGNIRAWEVHKKIGSFAL
QENYNGAIVALEDGLYQLDFETGNLKFICNPEPDLPQNRLNDGRVDRQGRFVFGSMNRLE
DGNTASLYRLDADYKIEKLENNINTSNSICWSPDGTKLYFADTWQGEIWSYDYDLETGQI
SNKTIFCKIDTSDGGSADGSTVDREGYLWNAKVYSGQLVRYRPDGQIDRIIEMPVKKITS
AVFGGKNLDVLFVTSMSQPPLPRFPNDNQLRGSVFAIYGLGIQGIADARFMG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaagtactggtagatgtaaaaacaaaacttggagaatgcccaacttgggat
actgttcgccaacgcctattttgggtagatattgttgatggacgattattctgttgtgat
gaattcggtgggaatatacgggcgtgggaagttcataaaaaaataggttcttttgcttta
caagaaaattataacggcgcaattgttgcgctcgaagacgggttatatcaactcgacttt
gaaacaggcaacttaaaatttatttgtaaccctgaaccagacctacctcaaaatagatta
aatgatggtcgtgttgatcggcaaggtcgattcgtttttggctctatgaaccgccttgaa
gatgggaataccgcatctctttatcgattagatgcagactataaaatagaaaaattagaa
aataatattaatacttcaaatagtatttgctggagtcctgatggtactaagctctatttt
gcagatacatggcaaggtgaaatctggtcttatgattatgatcttgaaacaggccaaatc
tcaaataaaactattttttgtaagatagatacctcagacggtggttcagcagatggctcg
acagtagatcgtgaaggttatttatggaatgcaaaagtatattcgggtcagttagtacgt
tatcgtcctgatggacaaatcgaccgtattattgaaatgcctgtaaaaaaaattaccagt
gcagtttttggtggaaaaaatcttgatgtcttgtttgttacatctatgtcgcaaccacca
cttccaaggttccctaatgacaaccaattgcgtggtagtgtttttgccatttatgggcta
ggcattcaaggaatagccgatgctcgatttatggggtaa

DBGET integrated database retrieval system