KEGG   Acinetobacter baumannii 1656-2: ABK1_0171Help
Entry
ABK1_0171         CDS       T01819                                 

Definition
(GenBank) argS
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:abx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ABK1_0171
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abx01007]
    ABK1_0171
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abx03016]
    ABK1_0171
   03029 Mitochondrial biogenesis [BR:abx03029]
    ABK1_0171
Enzymes [BR:abx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     ABK1_0171
Amino acid related enzymes [BR:abx01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   ABK1_0171
Transfer RNA biogenesis [BR:abx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ABK1_0171
 Prokaryotic type
   Other AARSs
    ABK1_0171
Mitochondrial biogenesis [BR:abx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ABK1_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1f tRNA-synt_1g Rep_3 T7SS_ESX1_EccB
Motif
Other DBs
NCBI-ProteinID: ADX01805
Position
complement(189162..190952)
Genome map
AA seq 596 aa AA seqDB search
MNTAIQAALDHAVQTLQQEGVLPSDWNNSSNLTRTKDRSHGDFASNIAMIGSKAAGMKPR
DLAEKILAALPEVADISKAEIAGPGFINFFLNADQRFAILDQIQAQKESFGRSQSNAAKK
IQVEFVSANPTSSLHVGHGRGAAYGMTVANLLEATGAKVDREYYVNDAGRQMDILATSTY
LRYLELLGQNLVFPKNAYQGDYVKEIAQGIIDKDGDAYVREVANVYKDVPEDVQYAEELD
SEGNKVVLSGDKEKHIDGLIANSQQLLGEGYRVFHQAALHAILDDIKDDLADFGVTFNQW
FSEASLSAKIDEALETLDQRGFLYEKDGNIWFKSTEFGDEKDRVVKRRNGQTTYFASDIA
YHLNKLQRGYTDLVDIWGSDHHGYISRVKAAIDAMGYDSKKLTVLLVQFVSLWRGGEMVQ
MSSRSGQFVTLRDLRKEVGNDAARFYYVMRKSEQHIDFDLDLAVSQSKDNAVYYIQYAHA
RICRMLEKAASTGLQFEVSAARSHAARLSLDAETEILAKLAAYPDVVLRAANAYEPHQVG
NYLKELAALFHGWYNEHKVLSDDAELTQARLLLSINVQQVLRNGLELLGVSAPEAM
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggcaatacaagcagctctcgaccatgcagtgcaaacccttcagcaagaaggt
gtgcttccttcggattggaataattcaagcaatttaacacgcaccaaagaccgaagccat
ggcgattttgcttctaatattgccatgatcggctctaaagctgctggtatgaaaccacgc
gatttagctgagaaaattctagcagcgctaccagaagttgcagacatcagcaaagctgaa
attgcaggccctggttttatcaatttctttttaaatgcagatcaacgttttgcaattctt
gaccagattcaagctcaaaaagaaagctttggtcgtagccaatcaaatgcagctaaaaag
attcaagttgaatttgtttctgcaaacccgacgtctagcctacacgtaggtcatggccgt
ggtgctgcttatggtatgactgttgcaaacttgcttgaagcaacaggtgctaaagttgac
cgtgagtactacgtgaatgatgctggccgtcaaatggatattttggcgacttctacttat
ttacgttatttggaattacttggacaaaaccttgtattccctaaaaatgcatatcaaggc
gattacgttaaagaaatcgcacaaggcatcattgataaagatggcgatgcttacgttcgt
gaagttgcgaatgtttataaagatgtaccagaagacgtgcaatatgctgaagagctagat
agcgaaggcaacaaagtcgtattatctggtgataaagaaaaacacattgacggtcttatt
gccaactcacaacaattattaggtgaaggctaccgcgtattccatcaagcagcacttcat
gccattttagatgatattaaagatgatcttgctgacttcggcgtaacctttaaccaatgg
tttagtgaagcatctcttagcgcaaaaattgacgaagcgttagaaacacttgatcaacgc
ggcttcttatatgaaaaagatggcaacatctggtttaaatcgactgaatttggtgatgaa
aaagaccgtgttgtgaagcgccgtaatggtcaaacgacttactttgcatctgacattgca
tatcacttaaataaactacaacgtggttatactgaccttgttgatatttggggttctgac
caccacggttatatctctcgcgtaaaagctgcgattgatgcaatgggttatgactcgaaa
aaattaactgttcttttagttcagttcgtaagcttatggcgtggtggtgagatggttcaa
atgtcatctcgttcaggtcagttcgtgactttacgtgacttgcgtaaagaagtcggcaat
gatgcagctcgtttctactacgtgatgcgtaaaagtgaacaacacattgactttgacctt
gaccttgctgtttcacaaagtaaagacaatgcggtgtattatattcaatacgctcatgca
cgtatttgccgtatgctagaaaaagcagcaagcactggcttacaatttgaagtaagtgct
gctcgttcacatgctgcacgtttatcacttgatgcagaaactgaaattcttgctaaactg
gctgcatatccagacgttgtgttacgtgctgctaatgcatatgaaccacaccaagtaggt
aactacttaaaagaattagctgcgctattccacggttggtacaatgaacacaaagtttta
agtgatgatgctgaacttacacaagcacgcttattactttcaatcaatgtacagcaagta
ttgcgcaatggcttagaattactcggtgtttctgcacctgaagccatgtaa

DBGET integrated database retrieval system