KEGG   Acinetobacter baumannii 1656-2: ABK1_0959Help
Entry
ABK1_0959         CDS       T01819                                 

Definition
(GenBank) Phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
abx  Acinetobacter baumannii 1656-2
Brite
KEGG Orthology (KO) [BR:abx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ABK1_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADX02593
Position
1061702..1063237
Genome map
AA seq 511 aa AA seqDB search
MPVFLTIIIATLIYIGFQVSADLAHVPPLSLYSVILLSTALLIALGFEFVNGFHDTANAV
ATVIYTNALPAPVAVMWAGFCNFLGVMVASGAVAYGIIALLPVELIMNMGSGAGFAMVFA
LLIAAILWNLGTWFLGIPASSSHTLIGSILGVGIMNHLLSASTGVTTSGVDMDQVIKVGK
ALLFSPLIGFAFAAIVFLLVKTIFKRQLELFQPPEGNKPPPAIIRAILIFTCTGVSFAHG
SNDGQKGMGLIMLILVGLVPLAYSLNKNLDTQQVQSFHQLSSQTAVLLNQNQPELTDEKA
RAVLTKYIQTKQQTPEVVPALASMTDHLGERVSSYSNLKDIPEAAISEIRNDMYLSTTTF
KRLDKADALPKMDDSQKKLVKDYRSSLDSFLQYIPNWVKVAVALALGLGTMVGWKRIVVT
VGERIGKHHMTYGQGMSAELVAMSTIAAADGLGMPVSTTHVLNSAVAGTMVANKSGLNFN
TVKTILSAWVFTLPATICLSGGLYWLFLQFV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgtttctgacgattattattgcaacacttatttatattgggtttcaggtcagt
gctgatttagcgcatgttccacctttaagcctttattcagttattcttttatctactgca
ctcttgattgcactaggctttgaatttgtaaacggtttccatgacactgctaatgcagtt
gcaacggttatttatacaaatgctttgcctgcaccggttgcagtcatgtgggcaggtttt
tgtaatttccttggggtaatggtcgcaagtggtgctgttgcgtatggcattattgcattg
cttccagttgaacttattatgaacatgggcagtggtgctggctttgcaatggtttttgca
ttgttgatcgctgcaattctttggaatcttggtacttggttcttgggaattcctgcttct
agctctcataccttgattggttcaatcttaggtgtgggtattatgaatcatctgttgagt
gcatcgactggcgtaacgaccagtggtgttgatatggatcaggtgattaaagtaggtaag
gcattattattttctcctttaattggttttgcttttgcggcaattgtattcttgttggtt
aaaactattttcaaacgccaattagaattattccagccacctgaaggaaataagccacca
ccagcaatcattcgcgcaattcttatctttacctgtacaggtgtgagttttgcacatggt
tctaatgatggccaaaaaggtatgggtcttatcatgctgattttggttggtttggtgcca
ttagcttattcattaaataaaaacctcgatacacagcaggttcaatcattccatcagctt
tcttctcaaactgcggttttgttaaaccaaaatcaaccagaattgactgacgaaaaagcg
cgtgcggttttaactaaatacattcaaaccaagcaacaaacgcctgaagttgtgcctgca
ttggcaagcatgactgaccatttgggtgagcgtgtttctagctatagcaacttaaaagat
attccagaagctgcaattagcgaaatccgtaatgacatgtatttgagcacaacgacgttt
aagcgtttggataaggcagatgctttaccaaaaatggatgactcacagaaaaagcttgtg
aaagattatcgtagtagcttggattcattcttacaatacattccaaactgggtgaaagtg
gcggtcgcattagcgcttggacttggtactatggttggctggaaacgtattgtggtaact
gtcggtgagcgtattggtaagcatcacatgacttatggtcaagggatgtctgctgagctt
gttgcaatgagtacaattgctgcagcagatggtttaggtatgccggtttcaacaacacac
gttttaaacagcgctgttgcaggtactatggttgccaataaatcaggcctgaatttcaat
actgtaaaaacaattctctctgcatgggtatttacacttcctgcaaccatctgtttgtcg
ggtggtttgtactggttattcttacagtttgtataa

DBGET integrated database retrieval system