KEGG   Acinetobacter baumannii 1656-2: ABK1_1745
Entry
ABK1_1745         CDS       T01819                                 

Definition
(GenBank) Putative uncharacterized protein
  KO
K11897  type VI secretion system protein ImpF
Organism
abx  Acinetobacter baumannii 1656-2
Brite
KEGG Orthology (KO) [BR:abx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abx02044]
    ABK1_1745
Secretion system [BR:abx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABK1_1745
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ADX03379
Position
1851024..1851500
AA seq 158 aa
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVIDD
YPLVKKSILQFGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMG
ALCLSIQAYLNIHPLYEPVVFDALLKPTTQQYVISART
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaacttagatcggctttatccatacggatttcgttcaactttatttgatcgtttaatt
ccagaaagtgaagattatgcaaaaggtctttctattcagcaattaagagaatctgtagca
aaggatttagaagatttgctcaatagtcgggtagcaaagttagatcatgtgattgatgac
tatccacttgtaaaaaaatcgatacttcagttcgggattattgattttgtggggctttct
acagccaaccctctggatcgggataaaatttgccaatccattgagcaatcaatagcagct
catgaacctcggctaagacaaatacgggtagagatgttattagatggacataatatgggc
gcattatgtttaagtattcaggcttatctaaatattcaccccttatatgaacctgttgta
tttgatgcattgttaaaaccaacaacgcagcaatatgtaatttcagcaagaacttaa

DBGET integrated database retrieval system