KEGG   Acinetobacter baumannii 1656-2: ABK1_1754
Entry
ABK1_1754         CDS       T01819                                 

Definition
(GenBank) Putative uncharacterized protein
Organism
abx  Acinetobacter baumannii 1656-2
SSDB
Motif
Pfam: PAAR_motif
Other DBs
NCBI-ProteinID: ADX03388
Position
1862370..1862633
AA seq 87 aa
MASPYITIGCPTTGGGQVISGNSAFLIEGIAIACVGDKATCPAHKTVSTIVSGDPNMQVM
GKAAARVNDSLSCGCKLLPKQSLVNQG
NT seq 264 nt   +upstreamnt  +downstreamnt
atggctagcccttacattacgattggatgcccaacgacaggtggagggcaagtcatttct
ggtaatagtgcatttttaattgagggaatcgcaattgcatgtgtaggtgataaagcaact
tgtccggcgcataaaacggtttctacgattgtttccggtgacccaaatatgcaagtgatg
ggaaaagcagcagcaagagtaaatgattcattatcgtgtggctgtaaattattaccgaaa
caaagtttggttaatcaagggtag

DBGET integrated database retrieval system