KEGG   Acinetobacter baumannii 1656-2: ABK1_3006Help
Entry
ABK1_3006         CDS       T01819                                 

Definition
(GenBank) sucC
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx00020  Citrate cycle (TCA cycle)
abx00640  Propanoate metabolism
abx00660  C5-Branched dibasic acid metabolism
abx01100  Metabolic pathways
abx01110  Biosynthesis of secondary metabolites
abx01120  Microbial metabolism in diverse environments
abx01130  Biosynthesis of antibiotics
abx01200  Carbon metabolism
Module
abx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABK1_3006
   00640 Propanoate metabolism
    ABK1_3006
   00660 C5-Branched dibasic acid metabolism
    ABK1_3006
Enzymes [BR:abx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ABK1_3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADX04640
Position
complement(3179687..3180853)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALLKEYGMPVQEGILATNADEAVAAFEQLGGKFAVMKAQVHAGGRGKAGGV
KVAKSKEDVIEFANNIIGTRLVTYQTDANGQPVNSIIVAEDVYPVERELYLGAVVDRSSR
RITFMASTEGGVEIEKVAEETPEKIIKVEVDPLVGLQPFQAREVAFALGLKDKQIGQFVK
IMTAAYQAFVENDFALFEINPLSVRENGEILCVDAKVGIDSNALYRLPKVAALRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYGGQPANFLDVGGGATKERVI
EAFKIILADTSVQGVLINIFGGIVRCDMIAEAIIAAVQEVNVTVPVVVRLEGNNAELGAK
LLDESGLKLISANGLSDAAEKVVAAVKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcaagctaaagcgttattgaaagaatatggtatgccggtacaa
gaaggtatcttggcaaccaatgcagacgaagcagttgctgcatttgaacagcttggtggt
aaattcgctgtaatgaaggcgcaagttcatgctggtggtcgtggtaaggctggtggcgtt
aaagttgcaaaatctaaagaagatgttatcgaatttgcaaacaatatcattggtactcgt
cttgtaacgtatcaaacagatgcaaatggtcaaccagtaaacagcatcattgttgctgaa
gacgtatatccagttgagcgtgagctttacttgggcgcggttgtagaccgttctagccgt
cgtattactttcatggcttctacagaaggtggtgtagaaatcgagaaagttgcggaagaa
actccagaaaaaattatcaaagttgaagttgatccattagttggtttacaaccattccaa
gcacgtgaagttgcgtttgctttaggtttgaaagacaaacaaatcggtcaattcgtgaaa
atcatgacagctgcttatcaagcatttgttgaaaatgatttcgctttatttgaaattaac
ccactttcagttcgtgaaaatggcgaaattttatgtgtagatgcgaaagtaggtatcgac
tctaacgcgctttaccgtttacctaaagttgctgctttacgtgataaatctcaagagaat
gagcgtgagttaaaagcatctgaatttgatcttaactatgttgctttagaaggtaacatc
ggttgtatggttaacggtgctggtcttgcaatggcaactatggacatcattaaactttat
ggtggtcagcctgcaaacttccttgacgttggtggcggcgcaactaaagagcgtgtaatc
gaagcgttcaaaatcattcttgctgatacgtctgtacaaggtgttttaatcaacatcttc
ggtggtatcgtgcgttgtgacatgattgctgaagcaattattgcagcggttcaagaagta
aatgtaactgttccagttgttgttcgtttagaaggtaacaacgctgagttaggtgcgaaa
ttacttgatgaatctggtttgaaattaatttctgcgaacggtttgtctgatgccgcagaa
aaagttgtagctgcagttaaagcgtaa

DBGET integrated database retrieval system