KEGG   Acinetobacter baumannii 1656-2: ABK1_3143Help
Entry
ABK1_3143         CDS       T01819                                 

Definition
(GenBank) Putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx00071  Fatty acid degradation
abx00072  Synthesis and degradation of ketone bodies
abx00280  Valine, leucine and isoleucine degradation
abx00310  Lysine degradation
abx00362  Benzoate degradation
abx00380  Tryptophan metabolism
abx00620  Pyruvate metabolism
abx00630  Glyoxylate and dicarboxylate metabolism
abx00640  Propanoate metabolism
abx00650  Butanoate metabolism
abx00900  Terpenoid backbone biosynthesis
abx01100  Metabolic pathways
abx01110  Biosynthesis of secondary metabolites
abx01120  Microbial metabolism in diverse environments
abx01130  Biosynthesis of antibiotics
abx01200  Carbon metabolism
abx01212  Fatty acid metabolism
abx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABK1_3143
   00630 Glyoxylate and dicarboxylate metabolism
    ABK1_3143
   00640 Propanoate metabolism
    ABK1_3143
   00650 Butanoate metabolism
    ABK1_3143
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABK1_3143
   00072 Synthesis and degradation of ketone bodies
    ABK1_3143
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABK1_3143
   00310 Lysine degradation
    ABK1_3143
   00380 Tryptophan metabolism
    ABK1_3143
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABK1_3143
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABK1_3143
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABK1_3143
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abx04147]
    ABK1_3143
Enzymes [BR:abx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABK1_3143
Exosome [BR:abx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABK1_3143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Tex_N
Motif
Other DBs
NCBI-ProteinID: ADX04777
Position
3331218..3332393
Genome map
AA seq 391 aa AA seqDB search
MTDIVIVNGARTAMGGFQGSLSGLTAPELGAVTIKEAIARAGLQPTDVEEVIMGCVLPAG
LKQGPARQAMRKAGLPDSTGAVTINKLCGSGMKAVMQAADMIKAGSAEIVVAGGMESMTN
APYVLPKARAGYRMGHGEIKDHMFFDGLEDAETGRLMGSFAQDMANTRGYTREQMDDFAI
RSLKRAQTAITEGYFKDEIVPVTVSTRKGDVIVDQDEQPLNAKIDKIPSLKPAFAKDGTI
TAANASSISDGASALVLTSSEVAAQRGLQPLAKIIATASNSQHPSEFTIAPVGAIEKVLK
KAGWNAQDVDLWEINEAFAMVTMCPIDDFKLDPEKVNIHGGACALGHPVGSTGSRIILTL
IHALKRTGGKKGVAALCIGGGEATAVAIEIL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatcgtaattgttaatggtgctcgtactgctatgggtggttttcaaggatca
ctatcaggactaactgctcctgaattaggagcagtaacaattaaagaagcaatcgcacga
gcaggtttacagcctacagatgtcgaagaagtcattatgggttgcgtactaccagcgggt
ttaaagcaaggccctgctcgtcaagccatgcgtaaagcaggtttacctgattcaacagga
gctgtgacaattaataagctttgtggttcaggtatgaaggcggtaatgcaagcggctgat
atgattaaagcaggaagtgctgaaattgtagttgccggtggtatggagtcgatgaccaat
gcgccttatgtcttacccaaagcacgtgcgggataccgtatgggccacggtgaaattaaa
gaccatatgttctttgatggcttagaagatgctgaaactggacgtttaatgggttcattt
gctcaagatatggcaaatacacgtggttatactcgtgagcaaatggatgactttgcaatt
cgttctttaaaacgtgctcaaactgcgattactgaaggctatttcaaagatgaaattgta
cctgttactgtttctacccgtaaaggtgatgtcattgtcgatcaggatgaacaaccctta
aatgccaagattgataaaatcccatcccttaaaccagcttttgcaaaagacggtaccatt
actgctgcaaacgcgagttcaatttctgatggtgcttctgcactagttttaacatcgagt
gaagttgcagcacagcgcggcttacaaccacttgcaaaaatcatagccactgcgtcaaat
tctcaacatccttcagaatttacaattgctcctgttggcgctattgaaaaagtacttaaa
aaagcaggttggaatgctcaggacgttgacctttgggaaattaatgaagcttttgctatg
gtaacgatgtgtccaattgatgatttcaaacttgatccagaaaaagtcaatattcatggt
ggagcatgtgcacttggtcatcctgtaggatcgacaggctctcgtattattcttacgctt
attcatgcgcttaaacgtactggtggtaaaaagggtgtcgctgctctttgcatcggcggt
ggggaagcaacagctgttgccatcgaaattctttaa

DBGET integrated database retrieval system