KEGG   Acinetobacter baumannii AYE: ABAYE0287Help
Entry
ABAYE0287         CDS       T00667                                 

Gene name
rrm
Definition
(GenBank) 23S ribosomal RNA G745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
aby  Acinetobacter baumannii AYE
Brite
KEGG Orthology (KO) [BR:aby00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aby03009]
    ABAYE0287 (rrm)
Enzymes [BR:aby01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ABAYE0287 (rrm)
Ribosome biogenesis [BR:aby03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ABAYE0287 (rrm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_32 Ubie_methyltran Methyltransf_9 PCMT TPMT MTS Methyltransf_8 Methyltransf_4 Methyltransf_12 Methyltransf_18 NodS PrmA tRNA_U5-meth_tr DREV FtsJ CMAS Pox_MCEL Methyltransf_29
Motif
Other DBs
NCBI-ProteinID: CAM85267
UniProt: B0V8P4
Position
307535..308359
Genome map
AA seq 274 aa AA seqDB search
MTTQNLMCPVCRQRLELVSKTWRCEQGHSYDIAKQGYVNLHVVQHKHSKNPGDTPESVDA
RRAFLQGGYYQPLQQAVVHLLKQLKAKTVLDIGCGEGYYTSAMQQVVEQCIGVDIAKNAV
QRAAKLNDKVTWVVGTGATLPVIDQSMDVCTSLFSPIPQTEILRVLKDDGYLIVVTPATD
HLYAMREALFEQVNPHTPQKFVEQLQDLFELKEQQVIDAPLVLDQQALKNLIAMTPYAYK
ASPERRMQLEQKAHLQVTASFQIYLFQKRNKKAI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgactacgcaaaatttaatgtgccctgtatgtcgtcaacgacttgagctggtaagcaaa
acatggcggtgtgaacagggccatagctatgacattgcaaagcaaggttatgtgaactta
catgttgtacaacacaaacatagtaaaaatccgggagatactcctgagtctgtagatgcg
cgccgtgcttttttacaaggtggctattatcaacctttacagcaagcagtagttcatttg
ctgaagcagcttaaagctaaaacggtacttgatattggctgtggcgagggctattacacc
agcgcaatgcaacaggtcgttgaacagtgtataggtgtagatattgcaaaaaatgcagta
caacgcgcagcaaagttaaatgacaaagtgacatgggtggttggtacaggagcaacttta
ccggtcatcgatcaaagcatggatgtgtgtacgagtctttttagcccgattccccaaacg
gaaattctgcgtgttttaaaagatgatggttatttaattgttgtgactccggcaaccgat
cacttgtatgcaatgcgtgaggcgttgtttgaacaggttaatcctcacacaccacagaag
tttgttgaacaactacaagatttatttgagttgaaagaacagcaagttattgatgctcct
ttagtacttgaccagcaagctttaaaaaatcttattgctatgactccctatgcttataag
gcatctccagagcgtcgtatgcaattagaacagaaagcacacttacaagtgaccgcatct
tttcaaatttatctttttcaaaagcgtaataaaaaagccatctaa

DBGET integrated database retrieval system