KEGG   Acinetobacter baumannii AYE: ABAYE0469Help
Entry
ABAYE0469         CDS       T00667                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07115  23S rRNA (adenine2030-N6)-methyltransferase [EC:2.1.1.266]
Organism
aby  Acinetobacter baumannii AYE
Brite
KEGG Orthology (KO) [BR:aby00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aby03009]
    ABAYE0469
Enzymes [BR:aby01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.266  23S rRNA (adenine2030-N6)-methyltransferase
     ABAYE0469
Ribosome biogenesis [BR:aby03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ABAYE0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsmJ Cons_hypoth95
Motif
Other DBs
NCBI-ProteinID: CAM85442
UniProt: B0V6S1
Position
484154..485011
Genome map
AA seq 285 aa AA seqDB search
MNYRHHFHAGNFADVMKHVLLLQLLNRLNAKDKPYRYIDTHGGAGKYDLSQAPAQKSGEF
LTGIHRLVQLSDMEKRQAPEAIQQYLKLVEELRAQEGKGSYPGSPWFALQGMREIDKATI
FEMQRDVFQQLRHNIHDKRAGLHERDAYEGLLAVIPPKEKRGLVMIDPPYELERKDFPQL
VELLQSAYKKWPTGVFAVWYPIKDRAMIERFEKKMFKTGIRRQLICEICVWPDDTPVGLN
GCGLLVINPPWQFSEQADQALQWLFPHLRMQETGGHAAVRWLVGE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaattaccgtcaccatttccatgcgggcaactttgcagatgttatgaagcatgtgctt
ttgctacagcttctcaaccgtttaaatgctaaagataaaccttatcgttatatcgatacg
catggaggtgcaggaaaatatgatctatctcaggcacctgcacaaaagtcaggagaattc
ctaacaggtattcatcgtcttgtacagctttctgacatggaaaagcgccaagctcctgaa
gccatccagcaatacttaaaacttgtagaagaattacgtgctcaagaaggtaagggaagt
tatccgggctctccgtggtttgctttacaaggtatgcgtgaaattgataaggctacaata
tttgaaatgcagcgtgatgtatttcagcaattacgccataacattcatgataaacgtgcg
ggcttgcatgagcgtgatgcatatgaaggcttgcttgccgtaattccaccaaaggaaaag
cgcggtttagtgatgattgatccgccttacgaattagagcgtaaggatttcccgcaattg
gttgaacttttacaaagcgcttataaaaaatggccaacaggtgtcttcgcggtttggtat
ccaattaaagatcgcgcaatgattgaacgttttgaaaagaaaatgtttaaaactggaatt
cgccgtcaattaatctgtgaaatttgtgtttggccagatgacacacctgtaggtttgaat
ggttgtggattattagtaattaatccaccttggcagttctccgaacaagcagatcaagcc
ctacaatggttattccctcacttacgtatgcaagaaacaggtggtcatgccgctgtacgc
tggttagtgggtgagtaa

DBGET integrated database retrieval system