KEGG   Acinetobacter baumannii AYE: ABAYE0524Help
Entry
ABAYE0524         CDS       T00667                                 

Gene name
dfp
Definition
(GenBank) bifunctional protein [Includes: 4'-phosphopantothenoylcysteine decarboxylase; phosphopantothenoylcysteine synthetase, FMN-binding]
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00770  Pantothenate and CoA biosynthesis
aby01100  Metabolic pathways
Module
aby_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ABAYE0524 (dfp)
Enzymes [BR:aby01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     ABAYE0524 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     ABAYE0524 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CAM85492
UniProt: B0V643
Position
539237..540490
Genome map
AA seq 417 aa AA seqDB search
MSFDLSVIPHKNIVLAVTGGIAAYKSAILVRRLKDYGFDVRVVMTHGAQAFITPLTFQAL
SGNPVHTELLDPEAEAGMGHIELARWADLLLVAPASCDTLAKFANGLADDLLSTLFLATK
APVWVAPAMNQQMWAAKATQRNLQTLVEDGVHVIMPDAGEQACGDVGLGRMPEPEEIARQ
VAGYFHQAQRAIAEKFGLLAGKRVVITAGPTREAIDPVRYISNHSTGKMGFALAAACYAA
GAKVTLIAGPVSLDTPNGVQRVNVASARQMLDVSMESLETGCDIFIATAAVADYRVAEVA
EHKIKKAGDELNVSLVKNPDIVATIAAQEKRPFMVGFAAETQNVEEYAAGKLVAKKLDMI
ACNDVSRADIGFASDENAMTVFFAESYHMKKRELEKASKQEISQQLVEAISDALRRK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgagctttgatttaagtgttattcctcataaaaacattgttttagctgttacaggtggg
attgctgcctataagagtgccattttggtccgtcgtcttaaagattatggttttgacgtt
cgggttgtgatgacacacggggctcaagcatttattacacctctaacttttcaggctctt
tcaggaaatcctgtacataccgagcttttagaccctgaggctgaagctggaatgggccat
attgaattggctcgctgggctgatttattactggttgctccagcaagttgtgacacatta
gctaagtttgctaatggtttggcagatgacttactcagtactttatttttagcaactaaa
gcgcctgtgtgggtcgctcctgcgatgaaccagcaaatgtgggctgcaaaagcaactcag
cgtaatttgcaaactctggttgaagatggcgtgcatgtgattatgccagatgcaggggag
caggcgtgtggtgatgtaggcttaggccgtatgccggaaccagaagaaattgcaaggcaa
gtggcgggttatttccatcaagcccaacgtgcaattgctgaaaaatttgggttgttggca
ggtaagcgagttgtaattactgctggaccaacccgtgaagcgattgaccctgttcgttat
atctcaaatcatagtactggaaaaatgggctttgctttagctgcggcatgttatgcagca
ggcgcaaaagttacgttaattgctggtcccgtaagtttagatactccaaacggtgttcaa
cgtgtaaatgttgcttcggctcgacaaatgttagatgtcagtatggagtcgcttgagact
ggctgtgacatctttattgcgacagcggctgtagctgattatcgcgttgccgaagtggca
gagcataaaattaagaaagcaggggatgagctgaatgtttcccttgtaaaaaatccggat
attgtggcaacgattgcagctcaggaaaaacgtccatttatggtaggctttgctgccgaa
acgcagaatgttgaagaatatgcagcagggaaactcgttgctaaaaagctagatatgatt
gcatgtaacgatgtttctcgtgctgatattggctttgcttctgatgaaaatgcgatgaca
gtattttttgctgaaagttaccatatgaaaaaacgtgagttagaaaaagcatctaagcaa
gaaatttctcaacaattggttgaagctatttcggatgcattacgccgtaaataa

DBGET integrated database retrieval system