KEGG   Acinetobacter baumannii AYE: ABAYE0629Help
Entry
ABAYE0629         CDS       T00667                                 

Definition
(GenBank) putative thiolase; acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00071  Fatty acid degradation
aby00072  Synthesis and degradation of ketone bodies
aby00280  Valine, leucine and isoleucine degradation
aby00310  Lysine degradation
aby00362  Benzoate degradation
aby00380  Tryptophan metabolism
aby00620  Pyruvate metabolism
aby00630  Glyoxylate and dicarboxylate metabolism
aby00640  Propanoate metabolism
aby00650  Butanoate metabolism
aby00900  Terpenoid backbone biosynthesis
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
aby01212  Fatty acid metabolism
aby02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABAYE0629
   00630 Glyoxylate and dicarboxylate metabolism
    ABAYE0629
   00640 Propanoate metabolism
    ABAYE0629
   00650 Butanoate metabolism
    ABAYE0629
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABAYE0629
   00072 Synthesis and degradation of ketone bodies
    ABAYE0629
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABAYE0629
   00310 Lysine degradation
    ABAYE0629
   00380 Tryptophan metabolism
    ABAYE0629
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABAYE0629
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABAYE0629
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABAYE0629
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aby04147]
    ABAYE0629
Enzymes [BR:aby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABAYE0629
Exosome [BR:aby04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABAYE0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-ProteinID: CAM85596
UniProt: B0V500
Position
complement(640668..641936)
Genome map
AA seq 422 aa AA seqDB search
MPFKTSTLKTQQSLSNKKGTVMSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNEL
QQRHQLDTSKVDDIVLGCVTPIGDQGGDIAKTAAIAAGWNDDVAGVQINRFCASGLEAVN
MAAMKVRSGWEDLVVAGGVESMSRIPMGSDGGPWALDPETNLKSSFVPQGIGADLIATLD
GYSREDVDNFAVKSQQKAAAAQSNGYFDQSVVPVKDHAGVVILEKDEFIKGNTTLEGLTK
LNPSFEMMGQMGFDAVALQKYPEAQKINHVHHAGNSSGIVDGAAVVLLASEKAVKEQNLK
PRAKVLATALVGTDPTIMLTGPAPAARKALEKAGLTIDDIDLFEVNEAFAAVVMRFINEL
NVPAEKVNVNGGAIALGHPLGATGAMILGTLLDELERQNKKRGLATLCVGGGMGIATIIE
RV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgccttttaaaaccagtacactcaaaacacaacaaagtttaagtaataaaaaaggaact
gttatgagcgaggcttatattattgatgccattcgcaccccacgcggaaaaggaaaaaaa
gatggctctctttacgaagtaaaaccaattacattactgacgaccttattaaatgaatta
cagcagcgccatcaactcgatacctctaaagttgacgatattgttttgggctgcgtaaca
ccaattggcgatcaaggtggtgacattgccaaaacagcagcgattgcagcaggttggaat
gatgatgttgctggggtacaaatcaatcgcttttgtgcatcaggtttagaagcagttaac
atggcagccatgaaagtccgctctggttgggaagatttagtggttgctggtggcgttgaa
tcaatgtcacgcattccaatgggttctgatggtgggccgtgggctttagatccagaaaca
aatcttaagtcatcatttgttccacaaggtattggggccgacctcattgcaaccttagat
ggctatagccgtgaagatgttgataatttcgctgtgaaatcacaacaaaaagctgcggca
gctcaatcaaatggttatttcgaccaatcagttgtgccggtaaaagatcacgcaggtgtg
gtaattttagagaaagatgaatttattaaaggcaataccacactcgaaggactaacgaag
ctcaacccaagttttgaaatgatgggccaaatgggctttgatgcagtcgctttacaaaaa
tatccagaagcacaaaaaataaatcatgttcatcacgcaggtaactcatcaggtattgtc
gatggagcagctgtagttttattagcttctgaaaaagctgtcaaagaacaaaatttaaaa
ccacgcgctaaagttttggcgactgcactggttggtaccgacccaaccatcatgctgact
ggtcctgcccctgctgcacgcaaagccttggaaaaagctggtttaacaattgatgatatt
gacctatttgaagttaacgaagcatttgcagctgtcgtgatgcgttttataaatgaactt
aatgtacctgctgaaaaagtcaacgtaaatggcggtgcgattgctttaggtcatccctta
ggggcaaccggtgccatgattttgggtacattacttgatgagcttgaacgtcaaaataaa
aaacgcggtttagcaacgctctgtgtcggcggtggtatgggtattgccaccattattgaa
cgtgtataa

DBGET integrated database retrieval system