KEGG   Acinetobacter baumannii AYE: ABAYE0722Help
Entry
ABAYE0722         CDS       T00667                                 

Gene name
ispA
Definition
(GenBank) geranyltranstransferase (farnesyldiphosphate synthase) (FPP synthase)
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00900  Terpenoid backbone biosynthesis
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABAYE0722 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:aby01006]
    ABAYE0722 (ispA)
Enzymes [BR:aby01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     ABAYE0722 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     ABAYE0722 (ispA)
Prenyltransferases [BR:aby01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ABAYE0722 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: CAM85683
UniProt: B0VEL0
Position
741244..742155
Genome map
AA seq 303 aa AA seqDB search
MSSLSQVNADVLKQAQQRIQQDLLTTLAAFSIPEPLKSAVHHAVMLGGKRVRPALCYATA
SLQDNPNFAAARRAAVAVELIHCYSLAHDDLPCMDNDLLRRGQPTCHVAFGEDTALLAGD
ILQSMAFEVLGSRLFDEQGQGTDAAIVLKQIQILATASSKMVCGQVLDLQAEAKQISQDE
LENIHRNKTGALIQAAIMMGAVTIFSGTDQAIPKLRQYGQAIGLAFQVQDDILDITSSTE
TLGKTAGKDEQVQKSTYPALMGLEQAQIYAKELHDQAFEALAHFGENAKELVEISQFLLA
RTN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcactctctcaagttaatgcggatgttttaaaacaagctcaacaacgtattcaa
caagatttattgacgacactggctgcattctcaattcccgaacctttaaaaagcgctgta
caccatgcagttatgctcggtggaaaacgtgtgcgtccggctttgtgttacgctacagct
tctttacaagataatccaaattttgcggctgctcgccgtgctgcggttgctgttgaactc
atccattgttattccttagcacatgatgacctgccttgtatggacaatgatttgcttcgc
cgtggtcagccaacgtgtcatgttgcatttggtgaagataccgcgttacttgcgggtgac
attttacaatcgatggcatttgaagttttaggtagtcgtttgtttgatgagcaagggcag
ggaacggatgctgcaattgtcttaaagcaaattcaaattttagctacagctagttctaaa
atggtttgtggacaggtcttagacttacaagccgaagctaagcaaatttctcaagacgaa
ctagaaaatatccaccgtaataaaacgggtgcgcttattcaggctgccattatgatgggg
gcagtgacaattttctcgggtacagatcaggcaattccaaaactacgtcaatatggtcaa
gcgattggactggcttttcaggtccaagatgatattttggatattacgtcgagcactgaa
actttaggcaaaaccgctggtaaagacgaacaagtacaaaaatcgacttatcctgctcta
atgggactagagcaagcacagatttatgctaaagaattgcatgatcaagctttcgaagct
ttagcgcatttcggtgaaaatgcaaaagaattagttgagatttcacaattcctgttagct
cgtactaattaa

DBGET integrated database retrieval system