KEGG   Acinetobacter baumannii AYE: ABAYE0981Help
Entry
ABAYE0981         CDS       T00667                                 

Definition
(GenBank) putative pseudouridine synthase
  KO
K06181  23S rRNA pseudouridine2457 synthase [EC:5.4.99.20]
Organism
aby  Acinetobacter baumannii AYE
Brite
KEGG Orthology (KO) [BR:aby00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aby03009]
    ABAYE0981
Enzymes [BR:aby01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.20  23S rRNA pseudouridine2457 synthase
     ABAYE0981
Ribosome biogenesis [BR:aby03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ABAYE0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 FMN_dh
Motif
Other DBs
NCBI-ProteinID: CAM85926
UniProt: B0VCR2
Position
complement(1043285..1044073)
Genome map
AA seq 262 aa AA seqDB search
MKIVILNKPYDVLSQFRKDEAHMTVSDFVDDPTLRIAGRLDMDSEGLVFLTDHGGLNQFI
TNPANKKYKTYLVQVDGDVTEEALEQLRKGVELNDGMTLPAKAIKVSEPEWLWDRDPPVR
YRASIPTSWIEISICEGRNRQVRRMTSAVGFPTLRLIRTKIGTIDLVQLGLQPGETKEIE
PLLYPDFKDVPAEQPYRSRSYVKKPGGTGGKPMVRKNKDGSAKKSGTKRIWQMDESEKPR
RKTNGTTRPNTKAPRGRSRNSR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgtcattctcaacaaaccatatgacgttctctcccagtttcgtaaagacgaa
gcacacatgacggtctctgactttgtagatgacccgactttgcgcatagcaggccgtctt
gatatggactctgagggtttagttttcttaactgatcatggtggtttgaatcagttcatt
accaaccctgcgaataaaaaatacaaaacgtatttagttcaagttgatggcgatgtaacc
gaagaagcactcgagcagcttcgtaagggtgtagagcttaatgatggtatgactttacca
gctaaagcaattaaggtaagtgagcctgaatggttatgggaccgcgatcctcctgtacgt
taccgtgccagcattccaacatcttggattgaaatctctatttgtgaaggtcgtaaccgc
caagttcgtcgcatgacctctgcggtaggttttccgactttacgtctcattcgtacaaaa
attggtacgattgacttagttcaattgggattacaaccgggcgaaaccaaagaaattgag
cctctactctacccagactttaaagatgttccggctgaacaaccttatcgttcacgttca
tatgtgaaaaaaccgggtggcactggcggtaagccaatggttcgcaagaacaaagatggt
tctgcgaaaaaatctggtacaaagcgtatttggcaaatggatgaaagtgaaaaaccgcgt
cgtaagactaacggtacaacgcgtccaaataccaaagcaccacgtggtcgtagccgcaat
agccgataa

DBGET integrated database retrieval system