KEGG   Acinetobacter baumannii AYE: ABAYE1098Help
Entry
ABAYE1098         CDS       T00667                                 

Gene name
hdc
Definition
(GenBank) Histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00340  Histidine metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ABAYE1098 (hdc)
Enzymes [BR:aby01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     ABAYE1098 (hdc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Aminotran_5 SelA
Motif
Other DBs
NCBI-ProteinID: CAM86027
UniProt: B0VBU8
Position
1170915..1172066
Genome map
AA seq 383 aa AA seqDB search
MILSPADQERIETFWNYCLKHQYFNIGYPESADFDYSALFRFFKFSINNCGDWKDYSNYA
LNSFDFEKDVMAYFAEIFQIPFEESWGYVTNGGTEGNMFGCYLARELFSDSTLYYSKDTH
YSVGKIAKLLQMKSCVIESLDNGEIDYDDLIHKIKTNKESHPIIFANIGTTMTGAIDDIE
MIQERLAQIGIMRRDYYIHADAALSGMILPFVDHPQAFSFAHGIDSICVSGHKMIGSPIP
CGIVVAKRQNVERISVDVDYISTRDQTISGSRNGHTVLLMWAAIRSQTNLQRRQRIQHCL
KMAQYAVDRFQAVGIPAWRNPNSITVVFPCPSEHIWKKHYLATSGNMAHLITTAHHRDTR
QIDSLIDDVIFDLQGASKRTVGF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgattttatcgcctgctgatcaagagagaatagagacattctggaattactgtttaaaa
catcaatacttcaatattggatatcctgaatctgcagattttgattattcagctttattc
cgttttttcaaattctctattaataattgtggtgattggaaagactatagcaattacgca
ttgaattcttttgactttgaaaaagatgtgatggcgtattttgctgaaatttttcaaatt
ccctttgaagaaagctggggatatgtgaccaatggtggtacagagggtaatatgtttggc
tgctatctggcgcgtgagctattttctgattccacattatattactcaaaagatacgcat
tattcggtgggaaaaatcgccaaattattgcagatgaaatcttgtgtgatcgaatcattg
gataatggtgaaatcgactatgatgatttaatccataaaataaaaaccaataaagaaagt
caccccattatttttgcaaatattggtacgaccatgaccggtgcaattgatgatattgaa
atgattcaagagcgcttagcgcaaatcggaatcatgcgccgagattattatattcatgcc
gatgctgccttaagtggcatgattttaccttttgttgatcatcctcaagcgttttccttt
gctcatggtatcgactcaatctgtgtgtctggtcataaaatgattggctcaccgattccg
tgtggcattgttgtggccaaacgccaaaatgtagagcgtatatcagtagatgttgactat
atctctacacgtgatcaaaccattagcggttctcgtaatggtcataccgtcttgctgatg
tgggcggcaatacgtagccaaactaatttacaaagacgacagagaattcagcattgccta
aaaatggcccagtacgcggttgatcgctttcaggcagtgggcattcctgcttggcgaaat
ccgaattcaattactgtggtatttccgtgtccttctgagcacatctggaaaaagcattat
ctggcaacctctggaaatatggctcatttaattactacggcacatcaccgagatacacgt
cagattgatagcttaattgacgacgttatttttgatttacaaggtgcttctaaacgtaca
gttggcttttag

DBGET integrated database retrieval system