KEGG   Acinetobacter baumannii AYE: ABAYE1178Help
Entry
ABAYE1178         CDS       T00667                                 

Gene name
hisQ
Definition
(GenBank) Histidine transport system permease protein (ABC superfamily, membrane)
  KO
K10016  histidine transport system permease protein
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aby00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ABAYE1178 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aby02000]
    ABAYE1178 (hisQ)
Transporters [BR:aby02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    ABAYE1178 (hisQ)
   Histidine transporter
    ABAYE1178 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF1440 DUF1514
Motif
Other DBs
NCBI-ProteinID: CAM86103
UniProt: B0VBB9
Position
1263155..1263844
Genome map
AA seq 229 aa AA seqDB search
MSFSGYGPLLLSGTWMTIQLALLSLLLSVIIGLIGASSKLSNIKALRYVATAYTTLIRSV
PDLVIMLLLFYSLQLGLNQITEALQMDQIDINPFVAGVITLAFIYGAYFTETFRGAFQSV
PRGQIEAAMAYGMTPWQVFHRVLFPQMMRFALPGIGNNWQVLIKATALVSIIGLTDIVKI
TQDAGRSTMQLFFFSIVAAAIYLAITTVSNLILIWLERHYSAGVRKGQL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttctggctatgggccactccttcttagcggaacatggatgaccatacagctt
gcgctgttatcactcttgctttctgtcattattggcttaattggtgcgagttcaaaactc
tctaatattaaagccttacgttatgttgcaaccgcctataccacgctcatccgtagtgtg
cctgacttagtgattatgctgctgttattttatagcttgcagttgggcttaaaccaaatt
actgaagcactgcaaatggatcaaattgatatcaacccatttgtggctggtgtgattact
ttagcgttcatttatggtgcatattttaccgagacctttcgtggtgcatttcaatcggtt
ccaaggggacaaattgaagcagcaatggcctatgggatgacgccttggcaggtttttcac
cgtgtattattccctcaaatgatgcgttttgcattgcccggcattggtaacaactggcaa
gttttgattaaggcgaccgcattggtttctattattggcctgactgatattgtaaaaatt
acgcaagatgcaggtagaagtaccatgcaactgttctttttcagcatcgtcgctgctgcc
atttatttggcaattaccacagtgtcgaacctgattttaatatggcttgaacgtcattat
tctgctggtgtgaggaagggacaattatga

DBGET integrated database retrieval system