KEGG   Acinetobacter baumannii AYE: ABAYE1943Help
Entry
ABAYE1943         CDS       T00667                                 

Definition
(GenBank) putative (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABAYE1943
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ABAYE1943
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ABAYE1943
    1.1.1.-  
     ABAYE1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CAM86822
UniProt: B0VDZ0
Position
complement(1999629..2000702)
Genome map
AA seq 357 aa AA seqDB search
MREIIMKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCG
HPHPISGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLS
KNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGD
IALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVM
KITNGEGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRG
TIAYVNDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgagggagataataatgaaagcagcgcgtttttatgacagaggtgatattcgtattgaa
gatattcctgaaccagaagtcactcctggcactgtaggcattaaggtagcttggtgtgga
atctgtggtacagatttgcacgaatttatggaaggaccaatttttattccaccttgtgga
catccgcatcctatttcaggtgaatctgcaccgattaccatgggacatgaattttcaggt
gtggtttatgccgtaggtgaaggtgttgatgatattgaaattggtcagcatgtcgtcgta
gagccttatattgtggcggatgatgtaccgactggaccgggcgataattatcatctttcc
aaaaatatgaactttattggtttaggtggtcgtggtggtggtttatcggaaaaaatcgcg
gttaaacgccgttgggtgcatccaatttccaataaaattccactggatcaggcagcctta
attgaacctttatcggttggtcatcatgctttcgtacgtagtggtgcaaaggctggtgat
attgcactggttggcggtgcggggccaattggtttattgctttcggcaattttaaaagcg
aaaggtcttaaggtcatcattaccgaactaagtgccaaacgtaaagaaaaagccaaagag
tcgggagttgcagattatattttagacccgtcagaagttgatgttgtttctgaggtcatg
aaaattactaatggagagggtgtcgatgtcgcgtttgaatgtagtagcgttaacaaggta
ttagatactttggttgcggcagtgaaaccaacaggcgtcatagttatcgtttcgatttgg
agccatccagcatcaattaatgtgcatagtgtggtaatgaaagagctcgatgtaagaggc
acaattgcctacgtaaatgaccatcaagaaaccattaaactggtcgaagaaggtaaaata
aatctggaaccttttattacccagcgcattcaacttgatgatttgatttcacaaggtttt
gaaaccttaattcataacaatgaatcagccgttaagattattgtacatccataa

DBGET integrated database retrieval system