KEGG   Acinetobacter baumannii AYE: ABAYE1946Help
Entry
ABAYE1946         CDS       T00667                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00010  Glycolysis / Gluconeogenesis
aby00020  Citrate cycle (TCA cycle)
aby00620  Pyruvate metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
Module
aby_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABAYE1946 (acoC)
   00020 Citrate cycle (TCA cycle)
    ABAYE1946 (acoC)
   00620 Pyruvate metabolism
    ABAYE1946 (acoC)
Enzymes [BR:aby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABAYE1946 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: CAM86825
UniProt: B0VDZ3
Position
complement(2002943..2004478)
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRK
ILAKDGDTLPVGGLIAVCADSEISNAEIEKFIASLGGSAAKAPEASSEQSKSETFAPVAE
KAEQPQSVAASAPAPTKVAKGDYAVPESLQGYQTSDELFATPHALKLAEKHNVNLAKVRG
SGREGRISVQDIQKAVQAAGGQWPDVKQQTQAKVIKSTADDSQVLATPVARRLAKQWGIN
LNDCRVSGTRGRVCKEDVEAVYYRNNPTSVNEQSAQCAAQPQSTITTVAMNGMRKAIASR
LQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNV
QFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQ
PDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATL
SCDHRVIDGAVGAKFLASFKQFVENPALILV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaattaaaacgctggagatcccgaaatggggattatctatggaagaaggcacg
atcgcccaatggttgattaaagagggtgatagctttaataagggcgatgaaatttgtgaa
attgaaaccacaaaaatcgtcaatgtattagaagcaccttttgctggaacgctccgtaaa
attttagcgaaagatggtgatactttacctgttgggggtcttatagccgtatgtgctgat
agtgaaatttctaatgcagaaattgaaaaatttattgcatcactaggtggttcagcagct
aaggcccctgaagcatcttcggaacaaagtaaatcggaaacatttgcacctgttgctgaa
aaagccgaacaaccacagtccgtagctgcaagtgctccagctcctacaaaggtagcgaaa
ggtgactacgctgtaccagagtcattacaaggctatcaaacatctgatgagttgtttgca
acgccacatgcgttaaagcttgcagaaaagcacaatgtgaacttggcaaaagtcaggggt
tctggtcgtgaaggacgtattagtgttcaagacatccagaaagctgtgcaggctgctggt
ggtcagtggcctgatgttaagcagcaaactcaagctaaagtgattaaatctacagccgat
gatagccaagttttagcgacacctgtagcacgtcgtttagcaaaacaatggggtattaac
ctaaatgactgccgtgtttcaggtactcgtggccgtgtctgcaaagaagatgttgaagca
gtttactatcgtaacaatccaacgtcggtaaatgaacaatctgctcaatgtgcagctcaa
ccacaatcaacaattacgactgtggcgatgaatgggatgcgtaaagcgattgcttcacgc
ttacaagctgcaaaacgtaatgcaccgcatttccgcttagtggtcgatctcaacgtagag
gctttgcaaaaattacgtaagcagattaatgaaacggttcctcaagtcaaactttctatt
aatgacatgctaattaaagcagctgctgcggcactgattaaagtgcctgaggtgaatgtt
caatttgatgaggcgactcaatcaattttacagttctctcaagcggatatttcggtggcc
gtagcgattccaaacggtttaattacacccattgtaaaagcagcgaatcagaagtcttta
gcacaaatttccgatgacatgcgtgatttggcaacgcgtgctaagactggcaagttacaa
cctgacgagtttcagggaggcagctttagcatttcaaatttaggaatgttaggcattaaa
cagttcgatgccattattaacccaccgcaaggtgcaattatggcattaggtgcttcggaa
tctcgcgctgttgtcgaaaatggcaatgtagtggttcgtgagattgtcacagcgacgttg
tcatgcgatcaccgagttattgatggcgcagttggggcgaaattcttggccagctttaag
cagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system