KEGG   Acinetobacter baumannii AYE: ABAYE2270
Entry
ABAYE2270         CDS       T00667                                 

Gene name
katE
Definition
(GenBank) Catalase hydroperoxidase II
  KO
K03781  catalase [EC:1.11.1.6]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00380  Tryptophan metabolism
aby00630  Glyoxylate and dicarboxylate metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ABAYE2270 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ABAYE2270 (katE)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     ABAYE2270 (katE)
SSDB
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI
Other DBs
NCBI-ProteinID: CAM87129
UniProt: B0VBH4
Position
complement(2313926..2316070)
AA seq 714 aa
MDMNDNTKSTNKTSEMAGADAANKANTTQKTEQLDTVRDDATNEALTTNQGVKIADNQNS
LRAGIRGSTLLEDFILREKITHFDHERIPERIVHARGVGAHGYFQAYEGNERLTKAGFLT
DPTIQTPIFVRFSTVQGPRGSADTVRDIRGFAIKFYTQEGNFDLVGNNAPVFFVQDGIKF
PDFVHAVKPEPDTEIPTGATAHDTFWDFVSLVPESAHAVIWAMSDRAIPRNLRSIQGFGV
HTFRLINAEGKSHFVKFHWTPKQGLSALVWDEAQKLAGKDPDFHRRDLYEAIEQGFYPEW
ELGVQIVEEEDEMNFDFDLLDPTKIIPEELVPVTPIGRFVLNRNVDNYFAETEQVAFCPG
HVVPGIDFTDDPLLQARLFSYTDTQLSRLGGPNFHQIPINKPVCPFHNNQRDGIHQHTIH
KGQAAYQPNSIDGNWPAETPPAASNGGFESYPEKISGHKLRQRSETFSDYFSQPRLYYKS
LAPHEQKHVVDAYTFELSKVQRKHIRERQVQQILANIDLDLARQVGANLGIEVPDLTLNY
KKTAVEKSAKLSFLAFPPEDIQGRKVAVLIHNMVKSDALEAIKNWAIKEGVILHLLAPSL
APVKDHKDNVIVADGMQMSEPSIAYDAVIIPDGDNLNTVMQDGVARHYLLEAYKHLKPIV
FLGNKSDLLEPLGLVADEGTLIEDEFQHVAEKFKNLIKAHRVWSREQIAAHVPA
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggacatgaacgacaatactaaatcaaccaataaaacaagtgaaatggctggtgccgat
gcagcaaataaagccaatactacccagaaaactgaacagttagacacagttagagatgat
gcaactaatgaagctttaaccacaaatcagggggttaaaatagcggataaccaaaatagc
ttaagagcgggtattcgtggctcgactttattggaagatttcattttaagagaaaaaatc
acccactttgaccatgagcgtatacctgagcgtattgtgcatgcgcgtggtgtaggggca
catggttattttcaggcatatgaaggaaacgaacgtttaaccaaagctggattcttgaca
gacccaactattcagacgcctatttttgtacgtttttcaacagtgcaagggcctcgtggt
tcagccgacactgttcgtgatatccgcggttttgccattaagttttatacccaagaaggt
aacttcgacttggtaggaaataacgcacctgtcttttttgtgcaagacgggattaaattt
ccagactttgtacatgcggtaaaacctgaaccggacacagaaatcccaacaggtgcaact
gcgcatgatactttctgggattttgtgtctttagtacccgagtcagcacatgctgtaatt
tgggcgatgtcagaccgtgcgattcctcgtaacttacgttcaatccaaggttttggtgtt
catacattccgtttaattaatgctgaaggtaaatcacattttgtgaaatttcactggaca
ccaaaacaaggtttgagtgcgctggtatgggatgaagctcaaaaacttgcaggtaaagac
ccagatttccaccgtcgtgatctttatgaagcaattgagcaaggtttttatccagaatgg
gaactcggcgtgcagattgtcgaagaagaagatgaaatgaactttgacttcgatttgctg
gacccaacaaaaattattcccgaagaattagttcctgttacaccaattggccgatttgtt
ttaaatagaaatgtagataactactttgctgaaacagagcaggtagctttctgtccgggt
catgtagtacctggtattgattttactgatgacccacttttacaagcccgactattttca
tacacagatacccagttaagccgtttaggcggaccaaacttccaccaaattccgattaac
aaacctgtgtgtccattccataacaatcaacgtgatggtattcatcagcataccattcat
aaaggacaggctgcatatcaaccaaactcaattgatggaaattggccagcagaaacaccg
ccagcggcatcaaatggtggttttgaaagttatcctgaaaaaattagtggacataaactt
cgtcaaagaagtgagacgttctctgattatttctctcaaccgcgactatattacaaaagc
cttgcaccgcatgaacaaaaacatgtggtcgatgcctatacttttgaattaagtaaagtt
caaagaaagcatattcgtgagcgtcaagttcaacaaattttggcaaatatcgacctagat
ttggcacgtcaagtaggggcaaatttaggtattgaagtgcctgacttaaccctaaactat
aagaaaacagcagttgaaaaatctgccaagttatcttttttagctttcccacctgaagat
attcaaggtagaaaagttgctgtacttatccataacatggtgaagtctgatgcattggag
gctattaaaaactgggcaattaaagaaggcgtaatccttcacttactagcgccgagcttg
gctccagtcaaagatcataaagataacgttattgtggctgatggcatgcaaatgtctgag
ccttcaattgcctatgatgcggtaattattccggatggcgataacctaaatacggttatg
caagacggggtagctcgccattacttactcgaagcttataagcacttaaagccaatcgta
tttttaggtaataaatctgatttgcttgaaccattaggtttagtggcggatgaaggaact
ttaattgaagatgagttccagcatgttgcggaaaaatttaagaacctgattaaagcacac
cgtgtttggtcacgagaacaaatagccgcacatgtaccggcttaa

DBGET integrated database retrieval system