KEGG   Acinetobacter baumannii AYE: ABAYE2307Help
Entry
ABAYE2307         CDS       T00667                                 

Gene name
dcaF
Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00071  Fatty acid degradation
aby00072  Synthesis and degradation of ketone bodies
aby00280  Valine, leucine and isoleucine degradation
aby00310  Lysine degradation
aby00362  Benzoate degradation
aby00380  Tryptophan metabolism
aby00620  Pyruvate metabolism
aby00630  Glyoxylate and dicarboxylate metabolism
aby00640  Propanoate metabolism
aby00650  Butanoate metabolism
aby00900  Terpenoid backbone biosynthesis
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
aby01212  Fatty acid metabolism
aby02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABAYE2307 (dcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    ABAYE2307 (dcaF)
   00640 Propanoate metabolism
    ABAYE2307 (dcaF)
   00650 Butanoate metabolism
    ABAYE2307 (dcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABAYE2307 (dcaF)
   00072 Synthesis and degradation of ketone bodies
    ABAYE2307 (dcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABAYE2307 (dcaF)
   00310 Lysine degradation
    ABAYE2307 (dcaF)
   00380 Tryptophan metabolism
    ABAYE2307 (dcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABAYE2307 (dcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABAYE2307 (dcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABAYE2307 (dcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aby04147]
    ABAYE2307 (dcaF)
Enzymes [BR:aby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABAYE2307 (dcaF)
Exosome [BR:aby04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABAYE2307 (dcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: CAM87163
UniProt: B0VBA6
Position
2353869..2355074
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAAEFGISREQA
DLFAAQSQAKYQKAKEEGFFVDEITPIEVFQGKKLPPKLVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIE
AIKKAVARAGLTLDDMDIIEINEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGA
SGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatctatgatggtttgcgtagtccatttggccgtcatgcgggtgaa
cttgcctcaattcgtcctgatgatttagcagcaacggtcattcaaaaactacttgaaaaa
actggtgtaccgggcgcggatattgaagatgtgatcttaggcgacaccaaccaagcgggt
gaagacagtcgtaatgtggcacgcaacgcgctgttacttgcaggtttacctgtcactgtg
ccaggccagacagtaaaccgtctatgtgcgagtggtttaggtgcagtaattgattcagca
cgtgctattacttgtggtgaaggtgagctctatatcgcaggtggtgtagaaagtatgtct
cgcgcaccttttgtgatgggtaaagccgaaagtgcttatagccgtgatgcaaaaatttat
gacaccaccattggttctcgctttcccaataaaaaaattattgcgcagtacggcggtcat
tcaatgcctgaaacgggcgataacgttgcagccgagtttgggattagccgtgaacaagcc
gacttatttgcagctcaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gtcgatgaaattaccccaattgaggttttccaaggcaaaaaattgccacctaaactcgtt
tctgaagatgaacaccctcgtccaagctcaactgttgaagcactcacaaagttaaaacca
ctctttgaaggtggcgtggttacagctggtaatgcttcaggtattaatgatggtgcagca
gcactcttgattggttcagaagcagcgggtcaaaaatatggcctaaaaccaatggcaaaa
atcttgtccgctgcggcggctggtattgagccacgcattatgggtgcaggtcctattgaa
gccattaaaaaagctgttgcgcgcgctggccttactttagatgacatggatattattgaa
attaatgaagcctttgcttcacaggttttatcttgtttaaaaggcttaaatgttgatttt
aatgacccacgtgtgaacccgaacggtggcgcaattgctgttggtcatccacttggtgct
tcaggcgctcgtcttgcgttaacagtagcgcgcgagttaattcgccgtaagaagaaatat
gccgtggtgagcctatgtattggtgtaggtcagggtcttgcaatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system