KEGG   Acinetobacter baumannii AYE: ABAYE2399
Entry
ABAYE2399         CDS       T00667                                 

Name
(GenBank) conserved hypothetical protein; putative exported protein
  KO
K17733  peptidoglycan LD-endopeptidase CwlK [EC:3.4.-.-]
Organism
aby  Acinetobacter baumannii AYE
Brite
KEGG Orthology (KO) [BR:aby00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aby01002]
    ABAYE2399
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aby01011]
    ABAYE2399
Enzymes [BR:aby01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     ABAYE2399
Peptidases and inhibitors [BR:aby01002]
 Metallo peptidases
  Family M15: zinc D-Ala-D-Ala carboxypeptidase family
   ABAYE2399
Peptidoglycan biosynthesis and degradation proteins [BR:aby01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   ABAYE2399
SSDB
Motif
Pfam: Peptidase_M15_4 VanY Peptidase_M15_3 Peptidase_M15_2 Pho86
Other DBs
NCBI-ProteinID: CAM87249
UniProt: B0VB12
Position
complement(2442813..2443766)
AA seq 317 aa
MMIFLIFFCFACLAIGLAFLMSYELRNKGRTFVLSLLPQGRRQLNQVRQFAQTMNQAAAP
EKLQSHWHLQQWWIVIAGFFLFASILIFAFTRPISSTRIEAEYLKKTDPQIYALLNGEIL
SPPPEVDESLIEAAIVEATQLEQQYASQESGVINSSPIDNTSFDGRAILDTSLVNRKWDK
MNPRYKQRLLMVFKIMKEQYGYELVLLEGYRSPARQNMLAGNPNTTRAKGYQSYHQFGLA
ADVAFKRNGKVVISERDPWAMQGYRLYGQVAESVGLTWGGRWKSIQDYGHTEYRMPGLKK
TQEMAEKLIAESLNDIS
NT seq 954 nt   +upstreamnt  +downstreamnt
atgatgatttttctaattttcttttgttttgcttgtcttgctatagggctagcatttttg
atgtcttatgagttaagaaataagggtagaacatttgttctatctttattacctcagggg
cgtcggcagctaaaccaagttagacaatttgctcaaacaatgaatcaggctgcggctcct
gaaaaactacaatcacattggcatttacagcaatggtggattgtaattgcaggatttttt
ttatttgccagtattttaatttttgcttttactcgcccaatcagttcaacacgaattgaa
gccgagtatcttaaaaaaactgatccgcaaatttatgcattattaaatggagaaatatta
tcgcccccacctgaagtagatgaaagcctgattgaagctgcaattgttgaagcaactcag
ttagagcagcaatatgcttctcaagaaagtggtgttataaattcttcaccaattgataat
actagttttgatggccgtgcgattttagatacgagtttagtcaaccgtaagtgggataaa
atgaacccacgctataagcagcgtttgcttatggtctttaaaattatgaaagaacaatat
ggttatgaacttgttttgcttgaaggttatcgtagtccagcacgtcaaaatatgttggcg
ggcaatccgaatacaaccagagcaaaagggtatcaaagttatcatcaatttggtttagcg
gcagatgtggcctttaagcgaaacggtaaagttgttatttctgaacgtgacccatgggct
atgcagggttaccgcctatatgggcaagttgctgagtccgtcgggcttacttggggtggt
cgctggaaatctatacaagattatggccatacagaatatagaatgccaggcttgaagaaa
actcaagaaatggcggaaaagctgattgccgaaagcttaaatgacatcagttaa

DBGET integrated database retrieval system