KEGG   Acinetobacter baumannii AYE: ABAYE2411
Entry
ABAYE2411         CDS       T00667                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
aby  Acinetobacter baumannii AYE
Brite
KEGG Orthology (KO) [BR:aby00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aby02044]
    ABAYE2411
Secretion system [BR:aby02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABAYE2411
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CAM87261
UniProt: B0VB01
Position
complement(2458885..2460696)
AA seq 603 aa
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI
DKKLTDSYDVFTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRS
FKGVQCEFNTTQDVKLLPIHLSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEK
LPIYLDAISNFPLQVLDSIFKKGTSFAVKYGQTIVELSKNPFELIGFAEQESLLPLDQHT
HHAYRLLMEYFCFPEKFSYLKLDLDFLKRIPQHVSELELLIHFKLNLNDQAVVRNYSELN
IANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILEMNMVREKTNQ
EESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSL
NSLALMKGDAVSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGV
KAELQIDSSVFRGHSLYIFSQLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGK
TLL
NT seq 1812 nt   +upstreamnt  +downstreamnt
gtgatagaagagcttttaccgttttatgaaaaacaattacaagaatttggtcaacaatct
cgggaatttgcccaaaaatatccaaaaattgctcagcgcttatctttaaatcaagagcaa
attgatgacccacatattgaacgtctgattcaggctttttcgctgattgctgctcgaatt
gataaaaaactaacagacagttacgatgtttttactcgttctttatttgaggtgatgttc
cctcaatacttacgacattttcctgcgtgttcagttgttagttttgaagatattaataag
attaaacagcttacagaacctcatctcgtacctcaccatacggttttgaaatctcgtagt
ttcaaaggggtgcagtgtgagtttaatacaactcaagatgttaaattactacctattcat
ttaagtggtttagattttaaaactacacctagtgcacatatgcacttaaatcaaaatgcg
acgttgagccttaaatttgaaatttttaataatgctcatgcttgtttaactgatgagaag
cttcctatttatttggatgctatctctaattttcctctacaggtccttgatagtattttc
aaaaaaggaaccagttttgcggttaaatatggacaaacaattgtagaattgagcaagaat
ccattcgaattgattggttttgcagaacaagaaagtttattaccgcttgatcaacatacc
catcatgcttatcgtttgttgatggaatacttttgtttcccggaaaagtttagttatctt
aagctcgatttagattttttaaagcgaatacctcagcatgtatccgaacttgagctttta
attcatttcaaattaaacttaaatgatcaagccgttgttagaaactattctgagctaaat
attgcaaactttaaattatttactaccccagtaattaatttatttgaaaaatatgctgaa
ccccagaagatagttcataagcaattagaatatcctttagttacagatgcacatcatcct
gagttttatcaggtatattcaatacttgagatgaatatggtgcgtgaaaaaacaaatcaa
gaagaaagctatgttcctgttttgcctttttttgcgatgagccattaccacaatgataca
gctcgctttttttactcagtaaactatcaaaagttacagtccaatttcgttgaaatgggc
tattccattatttctaaaaatttaaatccattttcaacgcgctcagattttattagcacc
aaattattatgttcaaaccgtgatttacctcatgaagcactgggtcagtctaataacgta
ttaaatttaaatgatagtagcttggcgagacgtgccattgttttaaaacgacctaccaag
ccttataagtttgaacaaggccaaagtgaacagtggcgtgtgatctcgcatctttcatta
aatagcttggcgcttatgaaaggggatgctgtttctcatgttaaagagctgttggcttta
tataacttaccgcagtcaaaagaaaattatttaattatagaatcaattaaaaaattagaa
ttttcgcttacccataaacttgtagatggcaaaccatttccaatgtttgtaagaggagtg
aaagctgaattacaaattgattcatccgtatttagagggcatagcttatatatttttagt
cagttattaagtcgtgtttttaatttaaaggttcaaattaatagttttgttgatttggtg
gttaaggattattcatctcagcaggagttataccaatgcagtcagaacgttggtggcaag
actcttctgtaa

DBGET integrated database retrieval system